KEGG   Acidiphilium multivorum: ACMV_34000Help
Entry
ACMV_34000        CDS       T01446                                 

Definition
(GenBank) putative hydrolase
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
amv  Acidiphilium multivorum
Pathway
amv00562  Inositol phosphate metabolism
amv00564  Glycerophospholipid metabolism
amv01100  Metabolic pathways
amv01110  Biosynthesis of secondary metabolites
amv02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:amv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    ACMV_34000
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ACMV_34000
   00565 Ether lipid metabolism
    ACMV_34000
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ACMV_34000
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:amv02042]
    ACMV_34000
Enzymes [BR:amv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     ACMV_34000
Bacterial toxins [BR:amv02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   ACMV_34000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-ProteinID: BAJ82747
NITE: ACMV_34000
UniProt: F0IXI2
Position
complement(3694283..3696259)
Genome map
AA seq 658 aa AA seqDB search
MKRALIIACSALSAVSVAALAATGHEVVTQPDARGIVRKMMDAPQPMPSDAEMTAMVRRK
IKYVFVLYQENRSFDSYFGTFPGADGLYSQPASKTPGFVQTLINTNGSRTTISPFRIGPK
QYAWDTDDIDHSHARIVAKMHVVNGTARMDRFAITEEKKYSPHGDPSLEAKQFGELSMAY
EDCDTVPFLWRYADRFVLFDHVFQDIAGPSTPGNLSIFAAQTGLTQWAFHPNEATGTFKG
GPETTNAAGGRISEAGAGVPVVTDDDPFWGSPLDPDPKVPVNPHDFTSPHGAHVQINQTY
ASLALTTAGHAIRRETAHDENPRLDLADVRQDIAYLAAHGQKPVDWGWYEEGYGKAVSAA
HEGPTDADGVHAAYITHHNGPQYFGYVANNPAERDHLHGASAFFTALKTGGLPATGGVFY
LKGGYLNDMGLTPDNPSAKARRNFRGDDDHPAYSDSQISEAFVARAVNAIARSRYWKHAA
IIITWDDSEGDYDHVPPPIVVKGPDHEPLTFGPRVPLIVISPYARVHQISHTVGSQASVV
KFVDKVFGLTPLALLPDEMKGRRLGLKEFGEANVGPADAITPDTTDLMTAFDPARLDGKA
RPLPPSYAIIPDHDITSLPQFGGKGCQADGIVPTDVAKGIHTKIPADFNPLPKTNPSA
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcgcactcatcatcgcctgttcggcgctctccgccgttagtgtcgcggctctc
gccgcaaccgggcatgaggtcgtcacccagcccgatgcccgcggcatcgtccggaagatg
atggacgcaccgcagcccatgccgagcgacgcggaaatgacggccatggtccgtcgcaag
atcaaatacgtcttcgtgctctatcaggaaaaccgttccttcgactcgtatttcggcacc
ttccccggcgccgacgggctttattcgcagccggcctcgaaaacccccggcttcgtgcag
acgctgatcaacaccaacggcagccggaccacgatttcgccattccgcatcggcccgaag
caatacgcctgggataccgacgacatcgatcactcccacgcccgcatcgtcgccaagatg
catgtcgtgaacggcaccgcccgcatggaccgtttcgcgatcaccgaggagaaaaaatat
tctccgcatggcgatccttcactcgaagccaaacagttcggcgaactctccatggcctac
gaggactgcgacacggtgccttttctgtggcgctacgccgatcgcttcgtcctgttcgac
catgtcttccaggacattgccggcccctcgacgcccggcaatctctcgatcttcgccgcc
cagacgggcctgacccaatgggcgttccacccgaatgaggcgaccgggaccttcaaggga
gggccggaaaccaccaacgccgccggcgggcggatcagcgaggcaggcgccggtgtcccg
gtggtcacggacgacgatccgttctggggctcgccgctcgatcccgacccgaaggtgccg
gtcaatcctcacgacttcacaagcccgcacggcgcgcatgtgcagattaaccagacctat
gcctcactggccctgaccaccgcgggccacgcaatccggcgcgaaaccgcgcatgacgaa
aatccgcggctcgacctcgccgatgtgcggcaggacatcgcctatctcgccgcgcacggc
cagaagccggtcgactggggctggtacgaggaaggctacggcaaagctgtcagcgccgcg
cacgagggcccgaccgatgccgacggcgtgcacgccgcctacatcacccaccacaacggt
ccgcagtatttcggctacgtcgctaacaatccggcggaacgtgatcacctgcacggcgca
tccgccttcttcacggcgctgaagacgggcggcctgccggccacgggcggcgtgttctat
ctcaagggcggctatctcaacgacatgggcctgacgccggacaacccgagtgccaaggcg
cgcaggaatttccgcggtgacgacgatcatccggcctactcggactcgcagatcagcgag
gccttcgtcgccagggcggtgaatgcgatcgcccgcagccgctactggaaacacgcggca
atcatcatcacctgggatgattcggaaggcgattacgaccatgtgccgccaccgatcgtg
gtgaaggggccagaccacgagcccctcaccttcggcccgcgcgtgccgctgatcgtcatt
tcgccctatgcgcgggtgcaccagatctcccataccgttggcagccaggcctcggtggta
aaattcgtcgacaaggtattcggtctcaccccgctcgcccttctgccggacgagatgaag
ggccgccgcctgggcctgaaggaattcggcgaggcgaatgtcggcccggccgacgcgatc
acaccggacacgacggacctgatgaccgccttcgaccccgcgcgcctcgacggcaaggcc
cgcccgctgccgccgagctacgccatcatccctgatcacgacatcacctccctgccgcaa
ttcgggggcaagggctgccaggccgacggcatcgtcccgaccgatgtcgcaaagggcatc
cacacgaaaatcccggccgacttcaacccgctgccgaagaccaatccgtccgcctga

DBGET integrated database retrieval system