KEGG   Acidiphilium multivorum: ACMV_34160
Entry
ACMV_34160        CDS       T01446                                 

Definition
(GenBank) type VI secretion system family protein
  KO
K11899  type VI secretion system protein ImpD
Organism
amv  Acidiphilium multivorum
Brite
KEGG Orthology (KO) [BR:amv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:amv02044]
    ACMV_34160
Secretion system [BR:amv02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   ACMV_34160
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: BAJ82763
NITE: ACMV_34160
UniProt: F0IXJ8
Position
complement(3712989..3714482)
AA seq 497 aa
MLREAVLAGHFFGERHGGAASELASFLVAKPGQALQAWFGEAATLDLLRNPKALAARIDR
DIAAIDALLSDQLDTILHNPRLTRLEGSWRGLFWLASHIEPGRTIKLRVLHASWSEICRD
LERAPEFDQSETFRRIYEDEFGTPGGEPYGLLVMDYTIRHRPSADSPSDDVSALAALSAV
AAASFAPMIFSASPTLFGVDRMEELSGVADPASLFTGLEYRRFRNLGLRDDMRFIGLALP
RLRARAPWTDAPGAPSLFPYCERIEDSEDMVWFAPGYAVAFVVARAMATYEWPADMRGYL
EDWPGGGLFTAGTAAVFSADPYDGLDRFELEIALTDRQERGLVDAGLMPLTPLGYGGETV
IGAARSLQMPRRFGGPNTEAADANARLSAQFNTMICVSRFAHFLKVMGRDMTGAFRTAAE
IERTLGDWLRRFTNSNRDAGPETRARYPLLDASVQVRELPAKPGSFGCVIHLQPQYQLDD
IAASFRLVTEISAPGNR
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgctgcgagaggcggttctcgccggtcacttttttggcgagcgccacggtggcgcagct
tcggaactcgcctccttcctcgtggcgaagccgggccaggcgctgcaagcctggttcggt
gaggcggccacgctcgatcttctccgcaatcccaaggcgctcgccgcccggatcgatcgg
gacatcgccgccatagatgcccttctctcggatcaactcgacacgatcctgcacaatccg
cgcctgacccggctcgaaggcagctggcgcgggctgttctggctggcctcgcatatcgaa
ccgggcaggaccatcaagctacgcgtgctgcacgcatcctggagcgaaatctgccgcgat
ctcgaacgcgcgccggaattcgaccagagcgagaccttccgccgcatctacgaagacgaa
ttcggcacgcccggcggtgagccctatggtcttctggtgatggactacacgatccgccat
cgcccatcggccgactcaccgagcgacgacgtttcggcattggcggcgctttccgctgtc
gcggccgcgtccttcgccccgatgattttcagcgcctcaccgacactcttcggcgttgac
cggatggaggaactttcgggcgtggccgatccggcgagtctgttcaccggactggaatat
cgccgtttccgcaatctcggccttcgcgacgacatgcgcttcatcgggctcgctctgccg
cgccttcgtgcgcgcgccccatggactgacgcaccaggcgcccccagcctctttccctat
tgcgagcggatcgaggacagcgaagacatggtctggttcgcgcctggctacgcggtggcg
ttcgtcgttgcccgtgcgatggcaacctatgaatggccggcggacatgcgcggctatctc
gaggactggccgggtggcggcctgttcaccgccggtaccgcagctgtcttctccgccgac
ccgtatgacgggcttgaccggttcgaactggaaatcgccctgaccgaccggcaggaacgc
ggtctggtcgatgccgggctcatgccgctaacgcctcttggctacggtggggaaacggtg
attggtgccgcccgcagcctgcagatgccgcgccgcttcggcgggccgaacaccgaggcc
gccgatgccaatgcccgtctatccgctcagttcaacacgatgatctgcgtctcccgcttc
gctcatttcctcaaggtcatgggtcgggacatgacgggcgcctttcgcaccgcagccgaa
atcgagcgcacgctcggcgactggctgcgccgcttcaccaacagcaaccgcgatgccggc
ccggaaacacgggcacggtaccccctgctcgacgcatcggtccaggtacgcgaactgccg
gcaaagccaggttcgttcggatgcgtcatccacctccagccgcaataccagttggacgac
attgcggcctcgttccggttggtgaccgagatatcggcgccgggcaatcgctga

DBGET integrated database retrieval system