KEGG   Acidiphilium multivorum: ACMV_34180
Entry
ACMV_34180        CDS       T01446                                 

Definition
(GenBank) type VI secretion system family protein
  KO
K11901  type VI secretion system protein ImpB
Organism
amv  Acidiphilium multivorum
Brite
KEGG Orthology (KO) [BR:amv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:amv02044]
    ACMV_34180
Secretion system [BR:amv02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ACMV_34180
SSDB
Motif
Pfam: T6SS_VipA DUF4349 FliT DUF4142
Other DBs
NCBI-ProteinID: BAJ82765
UniProt: F0IXK0
Position
complement(3716000..3716506)
AA seq 168 aa
MSGSIHEKLNRVRKPRVHITYDVETDGAQIARELPFVMGVMGDFSGDPTQPLKPLSERKF
VQIDRDNFNDVMARMAPGLKLKVDNTLADDGTQMAVDLKFNSIEDFDPERVVEQVPALKS
LLETRNKLRDLMSKADRSEELESLLEQVLQNEAELKSLSGELGLGKEG
NT seq 507 nt   +upstreamnt  +downstreamnt
atgagtggcagtatccacgagaaactcaaccgcgtacggaagccgcgcgtgcacattacc
tacgatgtcgaaaccgacggcgcgcagatcgcacgcgaactgccattcgtgatgggcgtg
atgggcgatttctccggcgacccgacgcagccgctgaagccgctgtcggagcggaaattc
gtccagatcgaccgcgacaacttcaacgatgtcatggcccgcatggcgcccggcctgaag
ctgaaggtggacaacaccctggccgatgacggcacgcagatggcggttgacctgaaattc
aacagcatcgaggatttcgatcccgagcgtgtcgtcgagcaggttcctgccctcaaatcc
ttgctggagacgcgcaacaagctgcgcgacctgatgagcaaggccgatcgatcggaagaa
cttgagtcgctgcttgaacaggttcttcagaatgaagccgaactgaaatcgctctcgggc
gaactcggcctcggcaaggagggctga

DBGET integrated database retrieval system