KEGG   Acidiphilium multivorum: ACMV_34200
Entry
ACMV_34200        CDS       T01446                                 

Definition
(GenBank) type VI secretion system family protein
  KO
K11897  type VI secretion system protein ImpF
Organism
amv  Acidiphilium multivorum
Brite
KEGG Orthology (KO) [BR:amv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:amv02044]
    ACMV_34200
Secretion system [BR:amv02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ACMV_34200
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: BAJ82767
NITE: ACMV_34200
UniProt: F0IXK2
Position
3717649..3718170
AA seq 173 aa
MSGPIGFSDRVRDAGARVQLSLLDRLLDDEPDRDRDRPLSAGEALNMLRRSVRRDLEALL
NAKRRWRALPPALAELRNSIAGYGLPDYTAGSMSATGAREAFRAEVERTIRQFEPRFARV
SVTLVKAENPLDPTLYMRIEGLLHAEPAPEPISFNTVVDSTSAEIEVKGEGGV
NT seq 522 nt   +upstreamnt  +downstreamnt
atgagcggcccgatcggcttcagcgaccgggtgcgcgacgcgggcgcgcgggtacaactg
tcgctgctcgaccgattgctggacgatgaacccgatcgcgatcgggatcggccgctgtcc
gccggcgaagcgctcaacatgctgcgccggtcggtacgccgcgaccttgaggcgctgttg
aatgcgaagcgccgctggcgtgcattgccgccggcgctggcagagctgcgcaactcgatc
gcaggctacggactgccggactataccgccggcagcatgagcgccacaggcgcgcgcgag
gcgttccgcgcggaagtcgaacgcacgatccgccagttcgagccgcgatttgcccgcgtc
tcggtgacgctcgtcaaggccgagaacccattggaccccacgctctacatgcggatcgag
gggctgctgcatgccgagccggcacctgagccgatcagtttcaacactgtggtcgactca
acctcggccgagatcgaggtgaagggggaaggcggtgtctga

DBGET integrated database retrieval system