KEGG   Anaplasma marginale Dawn: U370_03255Help
Entry
U370_03255        CDS       T02898                                 

Definition
(GenBank) thiamine biosynthesis protein
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
amw  Anaplasma marginale Dawn
Pathway
amw00730  Thiamine metabolism
amw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    U370_03255
Enzymes [BR:amw01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     U370_03255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 ApbA 3HCDH_N NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AGZ79806
Position
complement(797716..798849)
Genome map
AA seq 377 aa AA seqDB search
MVKTAGIAGAGLVGRLLALALLQNGWRVSLFDRDDAIGKRSCGFVAGGMLSLYSEAETAG
NLVVELGHRSLELWPEILHSAGASECLKMLGSVIVAHTSDLHELERMCAIIRRKFTALFG
NLCISDEIHTLESGLSVRHGVYIQGEGCIDSMRLFSRLEAELIRLGIKWLCNTHVDEVVS
QTLVVGCQRHVFDMVFDCRGIGAKSAISGLRGVRGESMLLHAPEVAIGRPIRMVHPRYNV
YMVPRSEGKLIVGATEIESCDFSEVSVRSVLELLSAAYSVHRGFAEARVLGMMSACRPAF
SDNCPRIIVEDGVVRINGLYRHGYLSAPAIVEEVINLLKCGNARYSGLLHSGMEGGCEQQ
PHGAIHEAVHNSGMAKR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaactgcgggaatagcgggggctgggctcgtcggcagactactggccctggcg
ttactgcaaaatgggtggcgggtctcgctttttgatcgggatgacgcaataggcaaacgc
agctgcggatttgttgcggggggcatgctttccctgtattccgaagcggaaacagccggg
aatttggttgtagaattaggccatagatccttggaattatggccagaaattctccattcc
gcgggcgcgagcgaatgcctaaaaatgttagggagtgtaattgtagcccatacaagcgac
ctgcacgaactggagaggatgtgcgccatcatcaggcgaaaattcactgccctttttggc
aatctctgtatttccgatgaaattcacacgctcgaaagcgggctatctgtccgccacgga
gtgtacattcaaggagagggatgcatagacagcatgcggcttttttcgcgcctggaggct
gaattaattcgtctagggataaaatggctttgcaacacgcacgtggatgaagtagtgtct
caaacgttggtggtgggctgccagcggcacgtttttgatatggtttttgattgcaggggc
attggagctaagagcgcaatttccggtctgaggggggttagaggcgaaagtatgctactt
cacgctcctgaggttgcgatcggccgcccaatccgtatggtgcaccccagatacaacgtg
tacatggtacccagatctgaaggtaagttgatagttggtgctacggaaatagaaagctgt
gacttctcagaggtatcggttagatccgtgcttgaactgctatcggccgcatactcggtc
cacagaggttttgcagaggccagggtgcttggtatgatgtctgcatgtagacctgcattt
tcggacaactgtccaagaattatagttgaagatggtgttgtcaggataaacgggctgtat
agacatggatatctgagcgcaccggcaatagtggaggaggtaataaacctgctaaaatgt
ggaaatgcccgctactccgggcttctgcattcaggaatggagggaggatgcgagcagcag
ccgcatggtgctatacatgaggcagtgcataacagcggcatggcaaagaggtag

DBGET integrated database retrieval system