KEGG   Altererythrobacter marensis: AM2010_2089Help
Entry
AM2010_2089       CDS       T03951                                 

Definition
(GenBank) oxidoreductase
  KO
K05886  serine 3-dehydrogenase (NADP+) [EC:1.1.1.276]
Organism
amx  Altererythrobacter marensis
Brite
KEGG Orthology (KO) [BR:amx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AM2010_2089
Enzymes [BR:amx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.276  serine 3-dehydrogenase (NADP+)
     AM2010_2089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR NAD_binding_10 Epimerase Polysacc_synt_2 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AKM08149
UniProt: A0A0G3XC35
Position
complement(2217164..2217916)
Genome map
AA seq 250 aa AA seqDB search
MNRTALVTGATAGIGEACVRNLAAAGWRCVATGRRAERLEALVAELGSDKVHAAVFDVRD
EAARDDALGNLPDSFAGIDLLLNNAGLALGTSPAQEASLADWTTMIETNVTALVSLTHKL
LPALIERKGAVINISSVAANYPYSGGNVYGGTKAFVRQFALGLRSDLHGTGVRVTSIEPG
MVETEFTLVRTGGNKEAHERLYGGAQPMTAGDIADTVRWVAELPPHLNINTLELMPVSQS
YAGFQVARGG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggacggcactcgtcacgggcgcaaccgcgggcattggcgaagcctgcgttcgc
aatctcgccgccgccggctggcgctgtgtcgcaaccggacgccgcgccgaacggctggag
gcgctggtggccgagcttgggtccgacaaggttcacgcggcggtattcgatgtgcgcgac
gaagcggcacgcgacgacgcgctcggcaacctgcccgattcgttcgcggggatagacctg
ctgctcaacaacgccgggctggcgctgggcacgtcgccggcgcaggaagccagcctcgcg
gactggacaacgatgatcgaaaccaatgtgaccgcgctggtttcgttgacgcacaagctg
cttcccgccctgatcgagcgcaagggcgcggtgatcaacatctcgtccgtcgcggcgaat
tacccctattcgggcggtaacgtctacggcggcaccaaggctttcgtgcgccagttcgcg
cttggtctgcgcagcgatctgcacggcaccggcgtgcgggtgacctcaatcgagccgggc
atggtcgaaaccgaattcactctggtgcggaccggtggcaacaaggaagcgcacgagcgg
ctttacggcggcgcgcagccgatgacggccggcgatatcgccgacaccgtccgctgggtc
gcggaactgccgccgcatctcaacatcaacacgctggaactgatgccggtgagccagagc
tacgccggcttccaggtcgcgcgcgggggttga

DBGET integrated database retrieval system