KEGG   Altererythrobacter marensis: AM2010_2192Help
Entry
AM2010_2192       CDS       T03951                                 

Definition
(GenBank) GumB
  KO
K01991  polysaccharide biosynthesis/export protein
Organism
amx  Altererythrobacter marensis
Pathway
amx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:amx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AM2010_2192
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:amx02000]
    AM2010_2192
Transporters [BR:amx02000]
 Other transporters
  Pores ion channels [TC:1]
   AM2010_2192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Poly_export SLBB
Motif
Other DBs
NCBI-ProteinID: AKM08251
UniProt: A0A0G3XC92
Position
2336827..2337534
Genome map
AA seq 235 aa AA seqDB search
MSFFRNLLLALAGAGFLAGCATDRSTGMAPGIELTDLASLPAPEGGYVTRVQPGDQLEIN
VVNSELLSGMYIVDDNGELVFPLIGAVAVKGDSPTRVGEKIAQRLSGRYVRNPDVRVVPT
ELSQPTVSIGGEVEKPGAYPARLSRTLARAINNAGGLSEYAKSEDVLVLRTVNGQNYIGA
FNIEAIQRGNYPDPQIYADDIITVGDSPARRRLSQILQFMPLLSTTAILIDRVGR
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttttcaggaatctcctgctggcgcttgccggtgccggttttttggccgggtgc
gcgaccgaccgcagcaccggaatggccccgggcatcgagctgacagatctcgccagcctg
cccgcaccggaaggcggctatgtcacgcgcgtccagcccggcgaccagctcgaaattaac
gtagtgaactcagaacttctgagcggcatgtatattgtcgacgacaatggcgagctcgtg
ttcccgctgatcggagcggtcgcggtgaagggcgattccccaacgcgggtcggggaaaag
atcgcccaacgcctgtcaggccgctacgttcgcaaccccgatgtgcgcgtggtgcccacg
gagctttcgcaaccgaccgtctcgatcggcggcgaagtcgagaagcccggcgcctatccg
gcgcgcctctcacgaacgctggcacgcgcgatcaacaatgctggcggcctatccgaatat
gccaaatcggaggacgtccttgtactgcgcacggtcaacgggcagaactatatcggagcc
ttcaacattgaggctatccagcgcggcaattaccccgatccgcagatctatgccgacgat
atcatcacggttggcgattcgccggcaagacggcgtctgagccagattctccagttcatg
ccgctcctttcaactactgcgatcctgatcgatcgcgtcggacgctga

DBGET integrated database retrieval system