KEGG   Altererythrobacter marensis: AM2010_2544Help
Entry
AM2010_2544       CDS       T03951                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
amx  Altererythrobacter marensis
Pathway
amx00071  Fatty acid degradation
amx00072  Synthesis and degradation of ketone bodies
amx00280  Valine, leucine and isoleucine degradation
amx00310  Lysine degradation
amx00362  Benzoate degradation
amx00380  Tryptophan metabolism
amx00620  Pyruvate metabolism
amx00630  Glyoxylate and dicarboxylate metabolism
amx00640  Propanoate metabolism
amx00650  Butanoate metabolism
amx00900  Terpenoid backbone biosynthesis
amx01100  Metabolic pathways
amx01110  Biosynthesis of secondary metabolites
amx01120  Microbial metabolism in diverse environments
amx01130  Biosynthesis of antibiotics
amx01200  Carbon metabolism
amx01212  Fatty acid metabolism
amx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:amx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AM2010_2544
   00630 Glyoxylate and dicarboxylate metabolism
    AM2010_2544
   00640 Propanoate metabolism
    AM2010_2544
   00650 Butanoate metabolism
    AM2010_2544
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AM2010_2544
   00072 Synthesis and degradation of ketone bodies
    AM2010_2544
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AM2010_2544
   00310 Lysine degradation
    AM2010_2544
   00380 Tryptophan metabolism
    AM2010_2544
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AM2010_2544
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AM2010_2544
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AM2010_2544
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amx04147]
    AM2010_2544
Enzymes [BR:amx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AM2010_2544
Exosome [BR:amx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AM2010_2544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AKM08599
UniProt: A0A0G3XDD6
Position
complement(2715014..2716555)
Genome map
AA seq 513 aa AA seqDB search
MNEDGGNTPVIIGIGQISERTDAPDYRARSPMDLAGDALAAAIADAGAASGLPAAIDTLG
AIRQFEMSRPDTKAPFGRADNPPRAIARRVGANPHRAILETTGGQTGQNLIGEFATDIAQ
GRSEVAAIAGAEAISTVRALSKAGETRDWSEDVGDELEDRGYGLDDLFDTELLRHGAASA
IAHYALFENARRARLRLSPDSYRQAMGELFAPFTRVAAANPHAAAPVARTAHDLAAVTPR
NRIVAEPYPRMTVARDQVNQGAAIIVASMRKARELGVPESRWVHIHAVAAASEPSPMARA
DLGRSPASTAAIEAALARCGRTFDEIRHIDLYSCFAIPVFNLTDHFGLSVDDPRGLTLTG
GLPFFGGPGNNYSTHAIAEAVSRARATPGSYALVGANGGLMSKYSAAIYSTDAADWSGAD
RTIALPPQAAAVRKAIGEQTGLTVETYTIVESERGPLTIVLGRNSAGERIAANADMDHAE
TRAMFEDGAPFGARLTLSISAEDGRTLGQLAGG
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagacggcggcaatacaccggttatcattggcatcggccagatctccgaacgc
acggacgcgcccgattatcgcgcacgttcgccgatggatctcgccggtgatgctctcgcg
gccgcaattgcggatgccggcgcagcgtcggggctcccggcagctatcgatacgctgggc
gcaattcgccagttcgaaatgtcgcggccggatacgaaggcccccttcggcagagccgac
aatcccccgcgcgcgatcgctcgacgggtcggtgccaatccgcaccgggcaattctggaa
acgaccggcgggcagaccggtcagaacctgatcggcgaatttgccaccgatatcgcccag
ggccggagcgaggtcgccgcaattgcaggggcggaggcgatttcgaccgtccgcgcgctg
agcaaggccggcgaaacgcgcgactggtcggaagacgtgggcgacgaactggaagatcgc
ggctatggcctggacgatctgttcgataccgaactgctccgccacggtgccgccagcgcc
atcgcacactacgcgctattcgagaacgcccggcgcgcccgtctgcgcctttctcccgac
agctatcgccaggcgatgggcgaactgttcgcccccttcacccgcgtcgccgccgcgaat
ccccacgccgcggcgccagtcgcccgcaccgcgcacgatcttgctgccgtgacaccgcgc
aaccgcatcgtggccgaaccttatccgcgaatgacggtggcgcgggatcaggtgaaccag
ggggcggccatcatcgtcgcttcgatgcggaaagcgcgtgagctgggcgtccccgaaagc
cgctgggtccacatccacgccgtcgctgccgccagcgaaccatcgccgatggcacgcgca
gacctgggccgcagcccggcctctaccgccgcaatcgaggctgcgcttgcgcggtgcggg
cgcactttcgacgagattcgccacatcgatctctattcctgcttcgccattccggtcttc
aacctgaccgaccatttcgggctgtctgtcgacgatccgcgcggtctgacgctgaccggc
ggcctgccgttcttcggcggaccgggaaacaactattccacccatgcgattgccgaagcc
gtgtcgcgcgcgcgggcgacgccgggcagttatgccctcgtcggcgccaacggcgggctc
atgagcaaatattcggccgcgatctattccaccgacgctgccgactggtccggtgccgac
cgcacgatcgcgctgccaccgcaagcggcagccgtgcgcaaggcgattggcgaacagacc
gggctgaccgtggaaacctatacgatcgtcgagagcgagcgagggccgctgaccatcgtg
ctgggccgtaattcggcgggggagcggatcgcagccaatgcggacatggaccatgcggaa
acgcgtgcgatgttcgaagacggcgctcccttcggcgctcgcctcaccctctcgatctct
gccgaagacggccgcaccctggggcaattggctggcggctga

DBGET integrated database retrieval system