KEGG   Altererythrobacter marensis: AM2010_490Help
Entry
AM2010_490        CDS       T03951                                 

Definition
(GenBank) Protein ApaG
  KO
K06195  ApaG protein
Organism
amx  Altererythrobacter marensis
Brite
KEGG Orthology (KO) [BR:amx00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AM2010_490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AKM06577
UniProt: A0A0G3X5X8
Position
516966..517364
Genome map
AA seq 132 aa AA seqDB search
MKQLFQHAAITDGITVRVAVNFLPEQSQPDAGKWFWVYHIRIENESDERVQLITRHWRIT
DARGAVNLVDGEGVVGEMPVLAPGDSHDYVSGCPLATPHGSMEGFYTFHRADGTPLEVRI
PFFPLAAPAIAD
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagctgttccaacatgccgcgattaccgatgggattaccgttcgcgtggcggtg
aatttcctgcctgaacagtcgcagcccgacgcggggaagtggttctgggtctatcacatc
cggatcgagaacgagtccgacgaacgggtgcaactgatcacccgccattggcgaatcacc
gacgcgcgcggggctgtgaatctggtcgatggggaaggggtcgtgggcgaaatgcccgtt
ctggctccgggcgacagccatgactatgtatccggctgcccgctggcgacgccgcatgga
tcgatggaagggttttacaccttccatcgcgccgatggcacgccgctggaggtgcgcatt
cccttcttcccgctggcagcgccggcgatcgcggactga

DBGET integrated database retrieval system