KEGG   Schaalia meyeri: ADJ76_08660Help
Entry
ADJ76_08660       CDS       T04027                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
amy  Schaalia meyeri
Brite
KEGG Orthology (KO) [BR:amy00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    ADJ76_08660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 HemY_N
Motif
Other DBs
NCBI-ProteinID: AKU65790
Position
complement(1994072..1995136)
Genome map
AA seq 354 aa AA seqDB search
MDLNLILVSVVIAVALFFSYTNGFHDAANAIATSVSTRAWTPRAALLMAAVMNVVGAMMG
TAVAKTVGKGIISISRYAESTQPEMQHKGLVIILAALLGACIWNLVTWWFGLPSSSSHAL
IGGLVGAGIMSGTAVHWWGILDHVIIPMFASPIIGFIVGYIVMRCVLHLLRKAQYHRSMR
RFRAAQRFSSAAMALGHGIQDAQKTMGIIIMALLAGGYGETHQIYDPITGDLTVPMWVKV
SGALAISLGTMAGGGRIMRTIGRKIIDLDPARAFTAEAVSSSILYLCSYVIHAPISTTQV
VSTAIMGVGCTKRFSAVRWGVAGNIVVAWFLTLPAAALVSAIVYLAVALPLGVH
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtggatctgaacctgatcctcgttagcgtcgtcatcgccgtcgcgctgttcttcagctac
acgaacggattccacgacgcagcgaacgcgatcgcgacctcggtatcgacgcgcgcttgg
acgcctcgagcggcgctcctgatggcggcagtcatgaacgtcgtcggcgccatgatgggc
accgccgtcgctaaaacggtcggcaagggcatcatttcgatcagtcgttacgccgagtca
acgcagccggagatgcagcacaagggcctggtcatcatcctggccgcgctgctgggtgcc
tgcatctggaacctggtcacctggtggttcgggctgccttcttcctcgtcgcacgccctc
atcggcggcctcgttggcgccggcatcatgagcggcacggcggtccactggtggggcatt
ctggaccacgtcatcatcccgatgtttgcctcgccgatcatcggtttcatcgtgggctac
atcgtcatgcggtgtgtccttcatctgctgcgcaaggcgcagtatcaccgctcgatgcgc
cgcttccgtgcagcgcagcgcttctcatcggccgcgatggccctgggccacggcatccag
gacgctcaaaagacgatgggcatcatcatcatggcgctgctggccggtggatacggcgag
acgcaccagatctacgaccccatcacgggcgacttaacggtgcccatgtgggtcaaagtt
tcgggcgctctggcgatttcgttgggcacgatggccggcggcgggcgaatcatgcgcacg
atcggccgcaagatcatcgacctggatccggcgcgcgccttcaccgccgaggccgtgtcc
tcctcgatcctgtacctgtgctcctacgtcatccacgcccccatctcgacgacgcaggtc
gtatcgacggcgatcatgggcgtgggctgcacgaagcgcttttcggcggttcgttggggc
gtcgcaggcaacatcgttgtcgcgtggttcctgaccctgccagccgcggccctggtgtcg
gcaatcgtgtacctggcagtggctctgccgctgggggtccactag

DBGET integrated database retrieval system