KEGG   Amycolatopsis sp. BJA-103: BKN51_05025Help
Entry
BKN51_05025       CDS       T05296                                 

Definition
(GenBank) alpha/beta hydrolase
  KO
K16050  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase [EC:3.7.1.17]
Organism
amyb  Amycolatopsis sp. BJA-103
Pathway
amyb00984  Steroid degradation
amyb01100  Metabolic pathways
amyb01120  Microbial metabolism in diverse environments
amyb01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:amyb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    BKN51_05025
Enzymes [BR:amyb01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.17  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase
     BKN51_05025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 UPF0227
Motif
Other DBs
NCBI-ProteinID: AUI57648
UniProt: A0A2N8MIB0
Position
1102388..1103236
Genome map
AA seq 282 aa AA seqDB search
MTEGKYATVRGGLKLHYHEAGVEHPETVILLHGGGPGASAWSNFGRNLPVFAKNYRTLAI
DQPGFGRSDKPTEHPQYFRHSADAVVGLMDELGIERAHFVGNSLGGGASVRLALNHPQRA
GRLVLMGPGGLSLNLFAPDPTEGIKNLGRFSAPPGPSREKLEAFLRIMVHDQSLITDELI
DERFAAASAPESLAAMKAMGKSFAQPDTYEEGMLWREAHRLRQRVLLIWGREDRVNPLDG
ALLALKTIPRAQLHVFGGCGHWAQLEKFDEFNRLALDFLGAS
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaggcaagtacgccaccgtccgaggtggactgaagctgcactaccacgaagcg
ggcgtggagcatccggagacggtgatcctcctgcacggcggcggccccggcgcgtcggcg
tggagcaacttcggccgcaacctgccggtgttcgccaagaactaccgcacactggcgatc
gaccagccggggttcggccggtcggacaagccgaccgagcatccgcagtacttccgccac
agcgcggacgccgtcgtcgggctgatggacgaactcggcatcgagcgggcgcatttcgtg
ggcaactcgctcggcggaggggcttccgtccggctcgcgctgaaccatccgcaacgcgcc
ggacggctggtgctgatggggccgggcgggctgagcctcaacctgttcgcacccgatccc
accgagggcatcaagaacctgggccggttcagcgccccgccggggcccagccgggaaaag
ctcgaagccttcctgcggatcatggtgcacgaccagtccttgatcaccgacgaactgatc
gacgagcggttcgccgccgcgagtgcgccggagtccctcgcggcgatgaaggcgatgggc
aagtcgttcgcccagcccgacacctacgaggaaggcatgctgtggcgtgaggcgcaccgc
ctccgtcagcgtgtgctgctcatctggggccgcgaagaccgggtcaatccgctcgacggc
gccctgctcgcgctcaagacgatcccgcgggctcagctgcacgtgttcggcggctgcggc
cactgggcgcagctggagaagttcgacgagttcaaccggctggcactcgacttcctggga
gcctcctga

DBGET integrated database retrieval system