KEGG   Amycolatopsis sp. BJA-103: BKN51_10240Help
Entry
BKN51_10240       CDS       T05296                                 

Definition
(GenBank) beta-glucosidase
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
amyb  Amycolatopsis sp. BJA-103
Pathway
amyb00460  Cyanoamino acid metabolism
amyb00500  Starch and sucrose metabolism
amyb01100  Metabolic pathways
amyb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amyb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BKN51_10240
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    BKN51_10240
Enzymes [BR:amyb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     BKN51_10240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Topo_C_assoc
Motif
Other DBs
NCBI-ProteinID: AUI58548
UniProt: A0A2N8MLH6
Position
complement(2501848..2503257)
Genome map
AA seq 469 aa AA seqDB search
MTMSAHPDSVRAKTALLFPPGFVWGAATAAFQVEGATAADGRTDSIWDVFARRPGAVVGG
DTGEPGADHYHRYAEDVDLMRRLGLGAYRFSLSWPRIRPDGGEPNPHGLAFYDRLVDRLL
EAGIQPWATLYHWDLPQVLEDGGGWASRETAFRFAEYAETIVARLGDRVANWSTLNEPWC
AAMLGYASGIHAPGRREPRAAVAAAHHLLLGHGLAMDVLRRHAPAASSGITLNLYPVSTA
DPSSTVDIEAARRVDGLQNRLFLDPVLRGSYPADLVADLAPLGFEELVREGDLATIAAPI
DWLGINYYRGYQVSGTPRPGSEPAGPDWLGVPDVHFVPDEAAPRTDSGWEVQPSRLTECL
LQVHRDYRQIPLYITENGASYPDALIGGDIVDTDRIAFLDSHLRAAYEAIEAGVDLRGYF
YWSLLDNFEWAEGYAKRFGLVHVDYATQRRTPKRSALWYARAISLNGLG
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatgtccgctcatcccgacagtgtccgggcgaagaccgcgctgctgttcccgccc
ggattcgtgtggggcgccgccaccgcggccttccaggtcgaaggggccacggccgccgac
gggcgcaccgactcgatctgggacgtcttcgcccgccgccccggcgccgtcgtcggcggc
gacaccggtgaaccgggggccgatcactaccaccggtatgccgaagacgtcgacctgatg
cggcggctcgggctcggcgcgtaccggttctccctgtcgtggccgcggatccggcccgac
ggtggcgagccgaatccgcacgggctcgcgttctacgaccggctcgtcgacaggcttctc
gaagcggggatccagccctgggcaacgctgtatcactgggatctcccgcaggtactggaa
gacgggggcggctgggcctcgcgcgagaccgcgttccggttcgccgagtacgccgaaacg
atcgtggcgcggctgggcgacagggtggcgaactggtccaccctgaacgagccgtggtgt
gccgcgatgctgggctacgcgagcgggatccatgctcccgggcgacgcgaacctcgcgcc
gccgtcgccgccgcgcaccatctcctgctgggtcacgggctcgcgatggacgtcctgcgg
cggcacgccccggcggcatcctcggggatcacgctgaacctgtacccggtgtcgacggcc
gatccttcgtccactgtggacatcgaagccgcccgccgggtcgacggcctgcagaaccgg
ctcttcctggatccggtgctgcggggctcctaccccgccgatctggtggccgacctggcc
ccgctcgggttcgaggagctggtgcgcgagggcgatctggccacgatcgcggcgccgatc
gactggctgggcatcaactactaccgcggttaccaggtctcgggcacccccagacccggc
agcgaaccggcgggccccgactggctcggcgtccccgacgtccatttcgtccccgacgaa
gcggcgccgcgcaccgactcgggctgggaggtgcagccctcgcgactcaccgagtgtcta
ctgcaggtgcatcgagactaccggcagatcccgttgtacatcaccgaaaacggcgcgtcc
tatccggacgcgctgatcggcggggacatcgtggacaccgaccggatcgccttcctcgac
tcgcatctgcgcgccgcgtacgaggcgatcgaggcgggcgtcgacctgcgcgggtacttc
tactggtcgctgctcgacaacttcgagtgggccgaggggtacgccaagcgcttcggcctc
gtgcacgtcgactacgcgacccagcgtcggacgccgaagcgaagcgcgctctggtacgcg
cgggcgatcagcctcaacgggctgggctga

DBGET integrated database retrieval system