KEGG   Amycolatopsis sp. BJA-103: BKN51_23165Help
Entry
BKN51_23165       CDS       T05296                                 

Definition
(GenBank) rRNA (guanine-N1)-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
amyb  Amycolatopsis sp. BJA-103
Brite
KEGG Orthology (KO) [BR:amyb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:amyb03009]
    BKN51_23165
Enzymes [BR:amyb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     BKN51_23165
Ribosome biogenesis [BR:amyb03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BKN51_23165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_31 Methyltransf_12 MTS Methyltransf_11 Methyltransf_33 Methyltransf_32 Methyltransf_23 Methyltransf_2
Motif
Other DBs
NCBI-ProteinID: AUI60797
UniProt: A0A2N8N3S5
Position
5424933..5425793
Genome map
AA seq 286 aa AA seqDB search
MNARASGNHPLPPEIVRSLRCSLCGDPVGAIEHTMRCERGHSFDVAKQGYVNLLHARIPA
GTADTAPMVAARVDLLASGVYLPLADALAEVASEHVQDGLIIDAGAGTGYYLAHVLDAVP
AAHGLALDVSAVALRRAARAHARAGAAVWNLWEPWPVASSSASLILNVFAPRNASQFHRV
LTADGLLVVATPNPGHLRELGDLVISVDGGKDARLEETLGERFGRVDRRDVTERVTLSPA
QIRQVVEMGPSAHHLHRDGRRERLDAIAEAVDVTTSFSVTLYRPVP
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacgtgcatccggcaatcacccgctgccaccggagatcgtccggtcactgcgg
tgttcgctctgcggtgacccggtcggggcaatcgagcacacgatgcgttgtgaacgtggc
cactcgttcgacgtagcgaagcagggctacgtcaatcttctgcacgctcgcatccccgcg
ggcacggcggacaccgcgccgatggtcgcggctcgcgtcgacctcctcgcttcgggtgtc
tatctccctctcgccgacgccctcgcggaggtggcttcagagcacgtacaggacgggctg
atcatcgacgccggcgcgggcacggggtactacctcgcgcacgtgctcgacgccgtcccc
gccgcgcacgggctggcgctcgacgtctccgccgtcgccctgcgccgggccgctcgcgca
cacgcgcgcgcgggcgcggccgtgtggaatctgtgggagccctggccggtggcgagctcg
agcgcgtcgctgatcctcaacgtcttcgcgccccgcaacgcctcacagttccatcgagtc
ctgaccgcggacgggctgctggtcgtcgcgacgccgaaccccgggcatctccgggagttg
ggcgacctggtgatctccgtcgacggcggcaaggacgcgcggctggaggaaaccctcggc
gagcgtttcggccgggtggaccggcgcgatgtcaccgaacgggtgacactgtcgcccgcc
cagatccgccaggtcgtcgagatgggcccgagcgcgcaccacctccaccgcgacggacgc
cgcgagcggctcgacgcgatcgccgaggcggtggacgtcaccacgtcgttcagcgtcacg
ctgtaccggccggtgccctga

DBGET integrated database retrieval system