KEGG   Amycolatopsis sp. BJA-103: BKN51_23815Help
Entry
BKN51_23815       CDS       T05296                                 

Definition
(GenBank) glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
amyb  Amycolatopsis sp. BJA-103
Pathway
amyb00260  Glycine, serine and threonine metabolism
amyb00630  Glyoxylate and dicarboxylate metabolism
amyb00670  One carbon pool by folate
amyb01100  Metabolic pathways
amyb01110  Biosynthesis of secondary metabolites
amyb01130  Biosynthesis of antibiotics
amyb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amyb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BKN51_23815
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BKN51_23815
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BKN51_23815
Enzymes [BR:amyb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     BKN51_23815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: AUI60914
UniProt: A0A2N8N3F9
Position
complement(5566292..5567383)
Genome map
AA seq 363 aa AA seqDB search
MSKETSLHGVHKGLGALFTDFAGWSMPIRYSSELAEHKAVRETAGLFDLSHMAEIEVTGP
QAADVLDFALVGNLSGVKPGRARYTMICDETGGVLDDLVVYRLEDEKFLVVANAGNAAVV
AEALAARVSGFDAVVDNKSEDVALIAVQGPKAVEILGAVTDADLGALKYYASVPAVVKGH
DVLLARTGYTGEDGFELYVPAGEAPAVWRILTEAGEPHGLLPAGLACRDTLRLEAGMPLY
GNELSLQLSPFEAGLGRVVKFEKPGDFVGKAALEELSKKDVPRVRVGLKGSGRRAPRHGY
SVLAGETEIGEVTSGALSPTLGYPIAMAYVDREHSEPGTELSVDIRGRIEPVEVVALPFY
SRA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaagagacgtccctgcacggagtccacaaaggactgggtgcgctgttcaccgac
ttcgcgggctggtcgatgccgatccgctacagcagcgagctggcggagcacaaggcggtc
cgcgagaccgcgggcctgttcgacctgtcccacatggccgagatcgaggtgaccggcccg
caggccgccgacgtcctcgacttcgcgctggtcggcaacctgtccggcgtcaagccgggc
cgggcgcgctacacgatgatctgcgacgagaccggcggcgtgctcgacgacctggtcgtc
taccgcctcgaagacgagaagttcctggtcgtggccaacgcgggcaacgccgccgtggtc
gcggaggcgctggccgcccgggtctccggcttcgacgccgtcgtcgacaacaagtccgaa
gacgtcgcgctgatcgccgtccagggcccgaaggccgtcgagatcctcggcgcggtcacc
gacgccgacctcggcgcgctcaagtactacgcgagcgtcccggccgtcgtgaagggtcac
gacgtcctgctcgcccgcaccgggtacaccggcgaagacggcttcgagctgtacgtcccg
gccggtgaggctcccgccgtctggcgcatcctcaccgaggcgggcgagccgcacggtctg
ctcccggccggcctcgcctgccgcgacacgctgcgtctcgaagccggaatgccgttgtac
ggcaacgaactcagcctccaattgagcccgttcgaggccggcctcggccgcgtcgtcaag
ttcgagaagccgggcgacttcgtcggcaaggccgcgctggaggagctgtccaagaaggac
gttccccgggttcgcgtcggcctcaagggttccggccgccgcgcgccgcgtcacggctac
tccgtcctggcgggcgagaccgagatcggcgaggtcaccagcggcgccctgtcgccgacc
ctgggctacccgatcgccatggcctacgtggaccgggagcactccgagcccggcaccgag
ctttccgtcgacatccggggccgcatcgagcccgtcgaggtcgtcgccctgcccttctat
tcccgcgcctga

DBGET integrated database retrieval system