KEGG   Amycolatopsis sp. BJA-103: BKN51_27535Help
Entry
BKN51_27535       CDS       T05296                                 

Definition
(GenBank) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
amyb  Amycolatopsis sp. BJA-103
Pathway
amyb00790  Folate biosynthesis
amyb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amyb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BKN51_27535
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amyb04147]
    BKN51_27535
Enzymes [BR:amyb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     BKN51_27535
Exosome [BR:amyb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BKN51_27535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AUI61554
UniProt: A0A2N8N1M4
Position
6358718..6359008
Genome map
AA seq 96 aa AA seqDB search
MAEILNDKQADEAVTKLSGWTRDGVTIERTAKLASFPKAIEAVDKIAELAEAADHHPDID
IRWRTVTFRLSTHSAGGLTEKDFALASQIDGVLADM
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaatcttgaacgacaagcaggcggacgaggccgtgacgaagctctcgggctgg
acccgcgacggcgtcaccatcgagcggacggcgaagctggcgagcttcccgaaagccatc
gaagcggtggacaagatcgccgaactcgcggaggcggccgaccaccatcccgacatcgac
atccgctggcggacggtgacgttccggctcagcacgcactccgccggagggctgacggag
aaggacttcgcgctcgcgtcgcagatcgacggggtactcgccgatatgtga

DBGET integrated database retrieval system