KEGG   Amycolatopsis sp. BJA-103: BKN51_30485Help
Entry
BKN51_30485       CDS       T05296                                 

Definition
(GenBank) Geosmin synthase
  KO
K10187  germacradienol/geosmin synthase [EC:4.2.3.22 4.2.3.75 4.1.99.16]
Organism
amyb  Amycolatopsis sp. BJA-103
Pathway
amyb00909  Sesquiterpenoid and triterpenoid biosynthesis
amyb01100  Metabolic pathways
amyb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amyb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    BKN51_30485
Enzymes [BR:amyb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.16  geosmin synthase
     BKN51_30485
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.22  germacradienol synthase
     BKN51_30485
    4.2.3.75  (-)-germacrene D synthase
     BKN51_30485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Terpene_synth_C
Motif
Other DBs
NCBI-ProteinID: AUI62074
UniProt: A0A2N8N025
Position
complement(6976347..6978560)
Genome map
AA seq 737 aa AA seqDB search
MQAFTLPEFYVPHPARMNPHLEAARAHSMAWAREKGMLDSPSPSGDAVWTEEALAKMDYA
LLCAHTHPDCDGPSLDLVTDWYVWVFFFDDDFLAQFKYTRNTEGAKAYLDRLELFMTGPG
ETSPEPENPAEAGLQDLWARTIPSMSEAWRRRFVTSTHNLMVESLWELDNIDRGRIANPI
EYVQMRRRVGGAPWSANLIEYTVGAEVPDKIAATRPMEVLRDTFADAVHLRNDLFSYQRE
VREEGENSNAVLVFEKFLDCPTQDAAELTNDLLTSRLQQFENTALVEVPALLAEHDVSLP
EQIGVGLYVKGLQDWQSGGHEWHAKSSRYMNEGPVSGVNGPAGLGTDSLRLSPNRLGLVQ
RTRQQAPAPFAPVGHLPLPEFRMPYPIRTSPHLAAAREYAPTWARAMGMFDAVPGVEHGA
IWDERRFRGFDFPHCAAMIHADSDLEQLKVSSDWLAWGTYGDDYFPLIFGMRRDPVAAKL
CSDRLSLFMPLDGEPVPEPANPVELGLVDLWNRTAGPLSPPARADFRRAIESMTASWVWE
VANQAQNRVPDPVDYVEMRRRTFGSDLTKSLARLELGDVVPPEIYQNRVLYELDTAAQDY
ATFTNDLFSYQKEIEYEGEVHNLVHVVERFLAVDRIEARDIAARLMNARMEQFEQLADED
LPRMCDDLGLDDEIRAVLTRYADNMKEWMSGILEWHRKCVRYTQGELERSRTPEPPVFSL
KPSGIGMSAWRIGSAAR
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcattcaccttgcccgagttctacgttccgcatccggcgcggatgaacccgcac
ttggaagccgcgcgggcgcacagcatggcctgggccagggaaaagggaatgctcgattcg
ccgtccccgtccggtgacgccgtctggaccgaagaagcgctggcgaagatggactacgcg
ctgctctgcgcgcacactcatccggactgtgacgggccgtccctcgatctggtcacggat
tggtacgtctgggtgttcttcttcgacgacgatttcctcgcccaattcaagtacacccgc
aacaccgaaggcgccaaggcttatttggaccggctggaactgttcatgaccgggccgggg
gaaacgtcgccggaaccggagaaccccgccgaggcgggcctccaggatctttgggcacgc
accattccctcgatgtcggaagcgtggcggcggcgtttcgtcaccagcacgcacaatctg
atggtcgaatcgctctgggaactggacaacatcgaccgcggccggatcgcgaaccccatc
gagtacgtccagatgcgccgtcgcgtcggcggggcgccgtggtcggcgaacctgatcgag
tacaccgtcggcgccgaagtgccggacaagatcgcggcgaccaggccgatggaggtcctg
cgcgacaccttcgccgacgctgtccaccttcgcaacgacctcttttcctaccaacgtgag
gtgcgcgaggagggcgagaactccaacgccgtcctcgtcttcgagaagttcctcgactgc
ccgacgcaggatgccgccgagctcaccaacgacctgctgacctcgaggctgcagcagttc
gagaacaccgcgctcgtcgaggtgcccgcgttgctggccgaacacgacgtctcgctgccc
gaacagatcggggtcggcttgtacgtcaagggcctgcaggactggcagtccggcggccac
gaatggcacgcgaagtcgagccggtacatgaacgagggcccggtctccggcgtgaacggg
ccggcaggactcggcacggactcgctgcggctctcgccgaaccggctgggcctggtccag
cggacgcggcagcaggcgcccgcgccgttcgcgccggtcgggcacctgccgctgcccgaa
ttccgcatgccgtacccgatccgcaccagcccgcatctcgccgccgcgcgggaatacgcc
ccgacctgggcgcgggcgatgggcatgttcgatgcggtgccgggcgtcgagcacggcgcg
atctgggacgagcgccggttccgcggtttcgacttcccgcactgcgcggcgatgatccac
gccgattcggacctcgagcagctcaaggtgtcttcggattggctcgcctggggtacctac
ggcgacgactacttcccgctgatcttcgggatgcggcgggaccccgtcgcggcgaagctc
tgcagcgaccggctctccctgttcatgccgctcgacggcgagccggtgccggagcccgcg
aacccggtcgaactcgggctcgtcgatctgtggaaccgcaccgcggggccgttgagcccg
cccgcgcgcgcggatttccgccgggcgatcgagagcatgaccgcgagctgggtctgggag
gtggcgaaccaggcgcagaaccgcgtccccgacccggtcgactacgtggagatgcggcgc
cgcaccttcgggtccgacctgacgaagagcctcgcccggctcgaactcggtgacgtcgtc
ccgccggagatctaccagaaccgggtcctgtacgaactcgacaccgccgcccaggactac
gcgacgttcaccaacgacctgttctcgtaccagaaggagatcgaatacgagggcgaggtg
cacaacctggtccacgtcgtcgagcggttcctcgccgtggaccggatcgaggcccgcgac
atcgccgcccggctgatgaacgcgcggatggaacagttcgagcagctcgcggacgaggac
ctgccgcggatgtgcgacgacctcgggctcgacgacgagatccgcgccgtgctcacccgg
tacgcggacaacatgaaggaatggatgtccggaatcctggaatggcaccggaaatgcgtg
cggtacacgcagggagagctggagcgctcccgcactcccgagccgccggtgttctcgctc
aagccgagcgggatcggcatgtctgcctggcggatcgggagtgcggcgcgctga

DBGET integrated database retrieval system