KEGG   Amycolatopsis sp. BJA-103: BKN51_35020Help
Entry
BKN51_35020       CDS       T05296                                 

Definition
(GenBank) hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
amyb  Amycolatopsis sp. BJA-103
Pathway
amyb00310  Lysine degradation
amyb01100  Metabolic pathways
amyb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:amyb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    BKN51_35020
Enzymes [BR:amyb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     BKN51_35020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 FAD_binding_2 Amino_oxidase Pyr_redox_2 Pyr_redox FAD_binding_3 HI0933_like Pyr_redox_3 AlaDh_PNT_C NAD_binding_7 GIDA Thi4 UDPG_MGDP_dh_N ApbA TrkA_N 3HCDH_N Lycopene_cycl Trp_halogenase IlvN FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AUI62854
UniProt: A0A2N8MW21
Position
complement(7913893..7915077)
Genome map
AA seq 394 aa AA seqDB search
MRTVVVIGGGIVGLATAWELTKRGLDVTVLEKEDRWAAHQTGHNSNVVHAGLYYKPGSFK
ARMSTAGNRSIVDFARQYGVPVEVCGKLVVATSEAELPALKVLAERAEANGVPAKLITPS
EAREYEPEVSCVAALRVESTGIIDFPAVCTALVRLLDESDADLRLGTPALGIRAGSTGGV
EVATGDDVIHADALVNCAGLHADRVARLAGLTPSARIVPFRGEYYELKPERRHLVRGLIY
PVPDASLPFLGVHLTRMLDGSVHAGPNAVLALRREGYTWRDVSAKDLAEVARFPGVWRLA
RKYAYPTGLDEVRRSFSRRRFAESLARLVPAVTEDDIVRHGSGVRAQALRPDGALVDDFL
IETARNQVHVLNAPSPAATSALEIAKHIADEVSD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcacagtcgtagtcatcgggggcggaatcgtcgggctcgccaccgcctgggagctg
accaaacgtggcctggacgtcacggtgctcgagaaggaggaccgctgggcggcccaccag
accgggcacaactcgaacgtcgtgcacgcggggctctactacaagccgggttccttcaag
gccaggatgtccaccgcgggcaatcggtccattgtggacttcgcccggcagtacggggtg
ccggtggaggtctgcggcaaactcgtcgtcgccacctccgaagcggagcttccggcgctg
aaggtgctcgccgaacgggccgaagccaacggcgtcccggccaagctgatcaccccgagc
gaagcccgcgagtacgaacccgaggtctcgtgcgtcgccgcgctgcgcgtggagtccacc
ggcatcatcgatttcccggccgtctgcaccgcgctcgtgcggctgctcgacgaatccgac
gccgacctccgcctcggcacgcccgcgctggggatccgcgcgggcagcaccggcggcgtc
gaggtggcgaccggcgacgacgtgatccacgcggacgcgctcgtcaactgcgcgggcctg
cacgccgaccgcgtcgcgcggctcgccgggctcaccccgagcgcgcggatcgtgccgttc
cgcggcgagtactacgaactgaagcccgaacgccgccatctggtgcgcggcctgatctac
ccggtcccggacgcgtcgctgccgttcctcggcgtgcacctgacccgcatgctcgacggc
agcgtgcacgccggccccaacgccgtgctcgcgctgcgccgcgagggctacacctggcgc
gacgtctccgcgaaggacctcgccgaagtcgcccgcttccccggcgtctggcggctcgcg
cgcaagtacgcgtacccgaccgggctcgacgaggtccgccggtcgttctcccgccgccgc
ttcgccgaaagcctcgcgcggctcgtgcccgccgtcaccgaggacgacatcgtgcggcac
ggctccggtgtccgggcacaggcactgcgcccggacggcgcgctcgtcgacgacttcctg
atcgagaccgcgcggaaccaggtgcacgtcctcaacgcaccctcaccggcggcgaccagc
gcactggagatcgccaagcacatcgccgacgaggtgtccgactag

DBGET integrated database retrieval system