KEGG   Amycolatopsis sp. AA4: CU254_04510Help
Entry
CU254_04510       CDS       T05278                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
amyc  Amycolatopsis sp. AA4
Brite
KEGG Orthology (KO) [BR:amyc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CU254_04510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ATY16160
UniProt: A0A2K8MA15
Position
918179..919297
Genome map
AA seq 372 aa AA seqDB search
MLVVVVICTALVFDFTNGFHDTANAMATSIATGALRPRVAVAISAVLNLAGAFLSVEVAK
TISSGLVDETRIGPAIVFGGLIGAIVWNLFTWYVGLPSSSSHALFGGLIGATWVSAGADS
VHFGKIVDKVLIPAAASPVIAGVAAAAVTYLVYRFLVRKRGGRGFRVGQIVSASLVSLAH
GTNDAQKTMGVITLTLVAAGSLPAGSAPPVWVIVSAASALALGTYLGGWRITHTLGKGLT
DIEGPQGFSAQTSSAVVILLSSHLGFPLSTTHVCSGGIIGSGVGRREAPVRWRMAGRMVL
AWLFTLPAAAIVGAAAGKIASLGEAGTIAVGVAGLLFAAGIYLLSRRKPVTAHSFQVPEP
SAADTEPDRLAA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
ctgctcgttgtcgtcgtgatctgcacggcgctggttttcgatttcaccaacggcttccac
gacacggcgaacgcgatggcgacttcgatcgccaccggagcactccggccccgcgtcgcc
gtcgcgatctccgcggtgctcaacctggccggcgcgttcctgtcggtcgaggtcgcgaaa
acgatttccagcggtctcgtcgacgagacgaggatcgggcccgccatcgtgttcggcggg
ctcatcggggcgatcgtctggaacctcttcacctggtacgtcggcctgccgtcgagttcg
tcgcacgcgctgttcggcggcctgatcggcgcgacctgggtgtcggcaggagcggactcc
gtccacttcggcaagatcgtggacaaggtgctcattccggccgccgcgtcgccggtgatc
gcgggagtggcggcggccgcggtcacctacctcgtctaccggttcctggtgcgcaagcgc
ggcggccgcggattccgggtcggacagatcgtttccgcgtcgctggtctcgctcgcgcac
ggcaccaacgacgcgcagaagaccatgggcgtcatcaccctgacgctcgtcgcggccggc
agcctccccgccgggtccgcgccgccggtctgggtgatcgtcagcgccgcgtccgcgctc
gcgctcggcacgtacctcggcggctggcggatcacccacaccctcggcaagggccttacc
gacatcgaaggcccgcagggcttttccgcgcagaccagcagcgcggtcgtgatcctgctg
tcctcgcacctcggtttcccgctgtcgaccacgcacgtctgctcgggcggcatcatcggc
tccggcgtcggccgccgcgaggccccggtgcgctggcggatggcaggccggatggtgctc
gcgtggctgttcacgctgcccgcggcggcgatcgtcggcgcggcggcgggcaagatcgcc
tcgctcggcgaggccggaaccatcgcggtcggcgtcgccggtcttctcttcgcggccggg
atctacctcctttcccgccgcaagcccgtcaccgcgcacagcttccaggtccccgaaccc
tccgccgccgacaccgaaccggaccgcctggctgcctga

DBGET integrated database retrieval system