KEGG   Amycolatopsis sp. AA4: CU254_05120Help
Entry
CU254_05120       CDS       T05278                                 

Definition
(GenBank) peptidase
  KO
K01416  snapalysin [EC:3.4.24.77]
Organism
amyc  Amycolatopsis sp. AA4
Brite
KEGG Orthology (KO) [BR:amyc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:amyc01002]
    CU254_05120
Enzymes [BR:amyc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.77  snapalysin
     CU254_05120
Peptidases and inhibitors [BR:amyc01002]
 Metallo peptidases
  Family M7: snapalysin family
   CU254_05120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M7 Peptidase_M6 Astacin Peptidase_M10 Peptidase_M66 Reprolysin_5 Reprolysin_4
Motif
Other DBs
NCBI-ProteinID: ATY09909
UniProt: A0A2K8LN96
Position
complement(1051619..1052173)
Genome map
AA seq 184 aa AA seqDB search
MSRKFVLSGAVALALAAAPLSGAVAVAAPAPSAVAAATVYYSTSGAPSFRAAINAGAANW
NRAVTNVKLVERSSGATLRYVEGNDPRGSYAQTDGHGHGTIFIDYTQARQYDNTRITAHE
TGHALGLPDHYSGPCSELMSGGGPGPSCHNANPNSQEASRVQRLWANGLSAVSGPQQRIY
DHAG
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgtccaggaagttcgtgctgtccggcgcggtcgcactcgcgctggccgccgccccgctc
tcgggcgccgtagcggtcgccgctccggctccttccgccgtcgcggcggccacggtctac
tactcgacgtccggcgcaccgtcgttccgagccgcgatcaacgcgggcgcggcgaactgg
aaccgcgcggtcaccaacgtgaagctggtcgagcgttcgtccggggccacgctgcggtac
gtcgagggcaacgacccccgcgggtcgtacgcgcagaccgacgggcacggccacggcacc
atcttcatcgactacacccaggcccgccaatacgacaacacgcggatcaccgcgcacgag
accggccacgcgctcggtctgccggaccactactccggcccgtgctcggaactgatgtcg
ggcggcggccccggcccgtcctgccacaacgccaacccgaactcgcaggaagcgtcccgg
gtgcagcggctgtgggccaacggcctcagcgcggtctccggtccgcagcagcggatttac
gaccacgccggctga

DBGET integrated database retrieval system