KEGG   Amycolatopsis sp. AA4: CU254_12380Help
Entry
CU254_12380       CDS       T05278                                 

Definition
(GenBank) toluene monooxygenase
  KO
K15761  toluene monooxygenase system protein B [EC:1.14.13.236 1.14.13.-]
Organism
amyc  Amycolatopsis sp. AA4
Pathway
amyc00623  Toluene degradation
amyc01100  Metabolic pathways
amyc01120  Microbial metabolism in diverse environments
amyc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:amyc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    CU254_12380
Enzymes [BR:amyc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.236  toluene 4-monooxygenase
     CU254_12380
    1.14.13.-  
     CU254_12380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TmoB
Motif
Other DBs
NCBI-ProteinID: ATY11174
UniProt: A0A2K8LRZ0
Position
2601399..2601653
Genome map
AA seq 84 aa AA seqDB search
MATIPLAVHFDGDFVLKLLPADSEHTMDELAAAAAENSVGIHVPDQPGRTLRVRRQGDAQ
PFERTSTVAAAGLEPTECVEVYFE
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atggccaccattccgctcgccgtgcacttcgacggcgacttcgtgctcaaactgctcccc
gcggacagcgagcacacgatggacgaactcgccgccgccgcggcggagaactcggtcggc
atccacgtgcccgaccagcccggccggacgctgcgggtgcgccgccagggcgacgcgcag
ccgttcgagcgcaccagcaccgtcgcggcggccggtctcgagccgaccgaatgcgtcgaa
gtctatttcgagtga

DBGET integrated database retrieval system