KEGG   Amycolatopsis sp. AA4: CU254_23740Help
Entry
CU254_23740       CDS       T05278                                 

Definition
(GenBank) 2,3-diaminopropionate biosynthesis protein SbnB
  KO
K21721  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase [EC:1.5.1.51]
Organism
amyc  Amycolatopsis sp. AA4
Pathway
amyc00998  Biosynthesis of secondary metabolites - other antibiotics
amyc00999  Biosynthesis of secondary metabolites - unclassified
amyc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amyc00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of secondary metabolites - other antibiotics
    CU254_23740
   00999 Biosynthesis of secondary metabolites - unclassified
    CU254_23740
Enzymes [BR:amyc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.51  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase
     CU254_23740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OCD_Mu_crystall
Motif
Other DBs
NCBI-ProteinID: ATY13112
UniProt: A0A2K8LXH3
Position
5120431..5121498
Genome map
AA seq 355 aa AA seqDB search
MTTQASAAESASAEPAAVPPFAVISGAQVQQALSGREREVVDLVETAYRVHGSGDSVNPP
SYFLRFPDRPADRIIALPASLGGKTNVAGLKWISSFPANVAAGIPRASAVLILNDLATGY
PFACLESSIISATRTAASAALAADWLSRTRQRPRRVGFFGVGLIARYIHTFLAGTGWEFD
EINVHDLNPDSAGGFRGYLEQAGFAGEISVHETAEGLVRDSDLVVFATIAGEPHVHDPSW
FSHHPLVLHVSLRDLAPEVLLASANFVDDVDHCLKANTSPHLVEQRTGSRDFLLGTLDDV
LTGRVSPPADRPVVFSPFGLGVLDLAVGAFVHERVSDAGGLHVIEDFFHELRRYG
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacgcaagcttctgccgccgaatccgcgtccgcggagccggcggccgtgccgccg
ttcgcggtgatctccggcgcccaggtccagcaggcgctgtccgggcgcgaacgcgaggtc
gtcgacctcgtcgaaaccgcctaccgggtgcacggctccggcgattcggtcaacccgccc
tcctatttcctgcgcttccccgaccgcccggccgaccggatcatcgccctgcccgcctcc
ctcggcgggaagaccaacgtcgcgggcctgaagtggatttccagcttcccggccaacgtc
gcggcggggatcccgagggcgtcggcggtgctgatcctgaacgacctcgcgaccgggtat
ccgttcgcctgcctggaaagctccatcatcagcgcgacccggaccgccgcctccgccgcg
ctcgccgcggactggctcagccggacccggcagcggccgcggcgcgtcgggttcttcggc
gtcggcctgatcgcccgctacatccacaccttcctcgccgggaccggctgggagttcgac
gagatcaacgtgcacgacctgaatccggacagcgcgggagggttccgcggctacctggag
caggcgggcttcgccggagaaatcagcgtgcacgagacggccgagggcctggtccgggac
agcgatctggtggtcttcgcgaccatcgcgggcgaaccgcacgtgcacgatccctcgtgg
ttctcgcaccatccgctggtgctgcacgtgtccttgcgcgatctggccccggaagtcctg
ctggcgtcggcgaatttcgtggacgacgtcgaccactgcctcaaggccaacacgtcgccg
catctcgtcgaacagcgcaccggcagccgggatttcctgctcggcaccctcgacgacgtg
ctgaccggccgcgtcagcccgcccgccgaccggccggtggtcttctcgccgttcgggctc
ggcgttctcgacctcgcggtcggggccttcgtccacgagagagtgtccgacgccggcgga
ctgcacgtcatcgaggacttcttccacgaactgcgccggtacggctga

DBGET integrated database retrieval system