KEGG   Arcobacter mytili: AMYT_1854Help
Entry
AMYT_1854         CDS       T05895                                 

Definition
(GenBank) short-chain dehydrogenase/reductase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
amyt  Arcobacter mytili
Pathway
amyt00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:amyt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    AMYT_1854
Enzymes [BR:amyt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     AMYT_1854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AXH15425
UniProt: A0A345J6J1
Position
1883011..1883790
Genome map
AA seq 259 aa AA seqDB search
MNEFMKGKTLVISGGTKGIGKACVYRFAQEGVNIAFTYNSNAEVAQEIADEVEREFGVKC
RCYAFNILEPEKYKELFEEIDKDFDRVDFFISNAMIYGRAVVGGYGRFMKLKPKGLNNIY
TATVNAFVCGSQQAAKRMEKVGGGAIVSLSSTGNLVYIENYAGHGTNKAAVEAMVRYAAT
ELGQMGIRVNAVSGGPIDTDALKAFTNYEEVRDKTAELSPLNRMGQPDDLASACYFLCTK
EASWVTGHTLIVDGGTTFK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagtttatgaagggtaaaacattagtaatttcaggtggtactaaaggtatagga
aaagcgtgtgtttatagatttgcacaagagggtgtaaatattgcttttacatataattca
aatgccgaagttgcacaagaaattgcagatgaagtagagagagaatttggcgtaaaatgt
agatgttatgcatttaatattttagaaccagaaaaatataaagagttatttgaagagatt
gataaggatttcgatagagttgatttctttatttcaaatgctatgatttatggaagagca
gtagttggtggttatggtagatttatgaaactaaaaccaaaaggtttaaataatatctat
actgcaactgtaaatgcttttgtatgtggttcacaacaagctgcaaaaagaatggaaaaa
gttggtggtggagcaattgttagtttaagttctactggaaacttagtatatattgaaaac
tatgcaggacatggtacaaataaagctgctgttgaagctatggttagatatgcagcaact
gagttaggacaaatgggaattagagtaaatgctgtaagtggtggacctattgatacagat
gctttaaaagcatttacaaactatgaagaagttagagataaaacagcagaattatctcca
ttaaatagaatgggacaacctgatgatttagcaagtgcatgctatttcttatgtacaaaa
gaagcttcatgggtaacaggtcacacgctaatcgttgatggcgggacaacgtttaaataa

DBGET integrated database retrieval system