KEGG   Arcobacter mytili: AMYT_2379Help
Entry
AMYT_2379         CDS       T05895                                 

Gene name
folA
Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
amyt  Arcobacter mytili
Pathway
amyt00670  One carbon pool by folate
amyt00790  Folate biosynthesis
amyt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amyt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AMYT_2379 (folA)
   00670 One carbon pool by folate
    AMYT_2379 (folA)
Enzymes [BR:amyt01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     AMYT_2379 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AXH15914
UniProt: A0A345J7Y0
Position
complement(2414057..2414560)
Genome map
AA seq 167 aa AA seqDB search
MKISMIVAYGKNWEIGLNNQMLWHISEDFKNFKQITSGHHILMGRKTFESIGKPLPNRTS
LVLSTKGFSSEGVHTFDSIEKALDFARQNGEEELFVIGGANIYETMFKYVDKMYLSEVDF
QGEADAYLKQIDFSTWDLIEQKEYEEIRQEQKLISPSWKFKVYVKKD
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatcaatgattgttgcttatggtaaaaactgggaaataggattaaataatcaa
atgctttggcatatttctgaagattttaaaaactttaaacaaattacaagtggtcatcat
attttaatgggaagaaaaacttttgaatctattggtaaaccgcttccaaatagaacttct
ttagttttatctactaaaggattttcttcagaaggtgttcatacttttgatagtattgaa
aaagctttagattttgcaaggcaaaatggtgaagaagagttatttgtaattggtggggca
aacatctatgaaactatgtttaaatatgttgataagatgtatttaagtgaggttgatttt
caaggggaagcagatgcttatttaaagcaaattgatttttccacttgggatttaatagaa
caaaaagagtatgaagaaattagacaagagcaaaagcttatctctccttcttggaaattt
aaagtttatgtaaaaaaagattaa

DBGET integrated database retrieval system