KEGG   Amycolatopsis mediterranei RB: B737_1638Help
Entry
B737_1638         CDS       T02804                                 

Definition
(GenBank) hypothetical protein
  KO
K16149  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
amz  Amycolatopsis mediterranei RB
Pathway
amz00500  Starch and sucrose metabolism
amz01100  Metabolic pathways
amz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B737_1638
Enzymes [BR:amz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     B737_1638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 DUF1957
Motif
Other DBs
NCBI-ProteinID: AGT82302
Position
complement(1769840..1771345)
Genome map
AA seq 501 aa AA seqDB search
MSEGTFCLVVHSHLPWLPHHGSWPVGEEWLYQAWAHSYLPMVELLERFADEGRRDVLTLG
VTPVLAAQLDDPYSIRAFHDWLGHWQLRAQHAATLWRGDPLLRELAAAEHRTAVRAAEEL
GTRWRHGFSPVLRSLVDNSTIELLGGPLAHPFQPLLDPRVREFALNAGLADTALRVGTRP
EGIWAPECGYAPGMENDYAAAGVRRFLVDGPSLRGETWAARPVGGTDVLAFGRDLEVTYR
VWSPKAGYPGHSAYRDFHTWQHEVGLKAARVTGKTVEPQDKAPYDPALAADVLATHVKDF
VETVVTRLRSLKRQHGREALVVAAYDTELFGHWWHEGPAWLEGVLRALPEAGVRVTTLEG
AMEAGHVGEPIDLPSSSWGSGKDWRVWDGEQVKDVVAANAALQDRLLDLVAGLDRTARDT
VADQAVAEAMLALESDWAFMVTKDSAADYARRRAAVHTERFDALAGLLRRGDRARAVELA
AAYRADDGPFGHLDARALKHD
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggggaccttctgcctcgtcgtgcacagccacctgccgtggctaccgcaccac
gggagctggccggtcggcgaggaatggctctaccaggcgtgggcgcactcctacctgccg
atggtcgagctcttggagcgcttcgccgacgaaggccgccgcgacgtgctgacgctgggc
gtgacgccggtgctggccgcacagctcgacgacccgtacagcatccgcgcgttccacgac
tggctcggccactggcagctgcgcgcccagcacgcggcgacgctgtggcgcggcgacccg
ctgctgcgcgagctcgccgcggccgagcaccggaccgccgtccgcgcggccgaagagctc
ggaacgcggtggcggcacgggttctccccggtcctgcggtccctggtcgacaattcgacc
atcgagctgctcggcggcccgctcgcccacccgttccagccgctgctggacccgcgggtg
cgcgagtttgcgctgaacgccggtctcgccgacacggccctgcgggtcgggacgcgaccg
gaggggatctgggcccccgagtgcggctacgcgcctggtatggaaaacgactacgcggcg
gcgggcgtgcgacggttcctggtcgacggcccctcgctgcgcggcgagacctgggccgcc
cggccggtcggcggcaccgacgtcctcgcgttcggccgggacctcgaggtcacctaccgc
gtctggtcgccgaaggccggctaccccgggcactccgcctaccgcgacttccacacctgg
cagcacgaggtcggcctcaaggcggcgcgggtcaccggcaagaccgtcgagccgcaggac
aaggcgccctacgacccggcgctcgccgcggatgtgctggcgacgcacgtgaaggacttc
gtcgagaccgtcgtgacgcgcctgcggtcgctgaagcggcaacacgggcgtgaggcgctc
gtggtcgccgcgtacgacacggagctgttcgggcactggtggcacgaaggaccggcgtgg
ctggaaggcgtcctgcgcgcgctccccgaggccggcgtgcgggtgacgaccctggagggc
gcgatggaagccggccacgtcggcgagccgatcgacctgccttcgtcgtcgtggggctcg
ggcaaggactggcgcgtctgggacggcgagcaggtcaaggacgtggtcgccgccaacgcg
gcgctgcaggaccggctgctggacctggtcgccgggctggaccggacggcccgggacact
gtcgccgaccaggccgtcgccgaggcgatgctggcgctggaaagcgactgggcgttcatg
gtcaccaaggactcggccgcggactacgcgcgccgtcgtgcggcggtccacaccgagcgc
ttcgacgcgctggccgggctgctgcgccgcggcgatcgcgcgcgcgccgtcgagctcgcc
gccgcctaccgcgccgacgacggaccgttcgggcacctcgacgcccgggcactgaagcac
gactga

DBGET integrated database retrieval system