KEGG   Amycolatopsis mediterranei RB: B737_2755Help
Entry
B737_2755         CDS       T02804                                 

Definition
(GenBank) glycosyl transferase
  KO
K13693  glucosyl-3-phosphoglycerate synthase [EC:2.4.1.266]
Organism
amz  Amycolatopsis mediterranei RB
Brite
KEGG Orthology (KO) [BR:amz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:amz01003]
    B737_2755
Enzymes [BR:amz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.266  glucosyl-3-phosphoglycerate synthase
     B737_2755
Glycosyltransferases [BR:amz01003]
 Others
  Glycosylglycerate
   B737_2755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_4 Glyco_tranf_2_2 ADH_N_2 DUF4088
Motif
Other DBs
NCBI-ProteinID: AGT83419
Position
2979085..2980089
Genome map
AA seq 334 aa AA seqDB search
MRNTHLQVTPAVGTWLARRSSKAEDWTTEELVAAKRGTTVSVVIPARNEEATVGAIVAAI
REELQEHHALVDEILVVDSHSTDATAEVAAAAGADVVAQDAVFPALEGLAGKGEALWKGV
AATTGDLVVFVDGDLHDFTTSYVTGLLGPLLTDPSVAYVKGFYHRPLGDQADGGGRVTEL
VARPLLNMFWPELSGFVQPLAGEYAGRREVLESIPFVVNYGVEIGHLIDLTELRGLDALA
QVDLGHRVHRHQSTQALGRMAGQIMLTLFDRLERYDRLVTAVPPATLLAQFQRGTSADGV
ERELVLTDLTSPQRPPLDSLPASIRPENALQETA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaacacacacctgcaggtgacgcccgcggtcggcacctggctcgcccggcgcagc
agcaaggccgaggactggaccaccgaagaactcgtcgcggccaagcgcggcaccacggtc
tcggtcgtcatcccggcgcgcaacgaggaagcgaccgtcggcgcgatcgtcgccgccatc
cgcgaagaactgcaggaacaccacgcactcgtcgacgagatcctcgtcgtcgacagccac
tccaccgacgccaccgccgaggtcgcggcggccgcgggggcggacgtcgtcgcgcaggac
gccgtcttccccgccctcgaaggcctggccggcaagggcgaggcgctgtggaagggcgtc
gcggcgacgaccggcgacctcgtcgtcttcgtcgacggcgacctccacgacttcaccacg
agctacgtcaccggcctgctcggcccgctgctcaccgatccgtcggtggcctacgtcaag
ggcttctaccaccggccgctcggcgaccaggccgacggcggcggccgcgtcaccgagctc
gtcgcacggccgctgctcaacatgttctggccggaactgtcggggttcgtgcagccactg
gccggcgagtacgcgggccgccgggaagtgctggagagcatcccgttcgtcgtcaactac
ggcgtcgagatcgggcacctgatcgacctcaccgagctgcgcggtctcgacgcactggcc
caggtcgacctcggccaccgcgtccaccggcaccagagcacccaggcgctggggcggatg
gccgggcagatcatgctgacgctgttcgaccgcctggagcgctacgaccggctggtcacg
gcggtcccgccggcgacgctgctcgcccagttccagcggggcacgtcggccgacggcgtc
gagcgcgaactggtgctgaccgacctgacctcgccgcagcgcccgccgctggacagcctg
ccggcgtcgatccggccggagaacgccctgcaggaaacggcgtag

DBGET integrated database retrieval system