KEGG   Amycolatopsis mediterranei RB: B737_6464Help
Entry
B737_6464         CDS       T02804                                 

Definition
(GenBank) threonine dehydrogenase-related Zn-dependent dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
amz  Amycolatopsis mediterranei RB
Pathway
amz00625  Chloroalkane and chloroalkene degradation
amz00680  Methane metabolism
amz01100  Metabolic pathways
amz01120  Microbial metabolism in diverse environments
amz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amz00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    B737_6464
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    B737_6464
Enzymes [BR:amz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     B737_6464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_N_assoc ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C HI0933_like FAD_binding_2 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AGT87128
Position
complement(7252086..7253222)
Genome map
AA seq 378 aa AA seqDB search
MKAVVYQGPRSVEVREVPEPKIEQPADAIVKITTTNICGSDLHMYEGRTNVEEGKILGHE
NMGFVAEIGSGVTRIKVGDRVSVPFNIACGTCRNCLEGWTSFCLRANPTEGVDGAAYGYA
NMGPYDGGQAEYLRVPWADFNLLELPGGTEHENDFTMLSDIFPTGWHGTELAGMRPGDRV
VVFGAGPVGLLAAHSAVIRGAAEVYVVDKERDRLAMAEKIGTIPIDLSEADPVEQIMAAT
GGAGADCGVEAVGYQAHDHTGEEHPELVLDNLVKTVRSTGGIGVVGVSLPDDPGAANELA
KHGRIAFDYGSLFMKGQHMGTGQAPVKRYNRQLRDLIITGKANPSFLVSHELPLDQAAEG
YEKFDHRDDGWTKVLLRP
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagtggtgtaccaaggaccgcgcagcgtcgaggtgcgtgaagtcccggaaccg
aagatcgagcagccggccgacgcgatcgtcaagatcaccacgacgaacatctgcgggtcg
gacctgcacatgtacgaaggccgcacgaacgtcgaagaaggcaagatcctcggccacgaa
aacatgggcttcgtcgccgaaatcgggtccggggtcacccggatcaaggtcggtgaccgg
gtgtcggtgccgttcaacatcgcctgcgggacctgtcgcaactgcctcgagggctggacg
tcgttctgcctgcgcgccaaccccaccgagggagtcgacggtgccgcctacggctacgcg
aacatgggcccatatgacggtggtcaggcggagtacctgcgcgtgccgtgggcggatttc
aacctgctggagctgcccgggggcaccgagcacgagaacgacttcaccatgttgtcggac
atcttcccgaccggctggcacggcaccgagctggccgggatgcgtcccggtgaccgggtc
gtggtgttcggcgccgggccggtcgggctgctggccgcgcacagcgcggtgatccggggt
gcggccgaggtctacgtcgtggacaaggaacgtgaccggctggccatggccgagaagatc
ggcaccatcccgatcgacctgtccgaggccgaccccgtcgagcagatcatggccgcgacc
ggcggcgcgggcgccgactgcggcgtcgaggcggtgggctaccaggcgcacgaccacacc
ggcgaagagcacccggagctggtgctggacaacctggtcaagacggtgcgttcgaccggc
ggcatcggcgtggtcggggtgtccctgccggacgacccgggcgcggcgaacgaactggcc
aagcacggccggatcgccttcgactacggcagcctcttcatgaagggccagcacatgggc
accggccaggccccggtcaagcgctacaaccggcagctgcgcgacctcatcatcaccggg
aaggcgaacccgtcgttcctggtctcgcacgagctgccgctggatcaggccgcggagggc
tacgagaagttcgaccaccgcgacgacggctggaccaaggtcctgttgcgaccgtga

DBGET integrated database retrieval system