KEGG   Amycolatopsis mediterranei RB: B737_7843Help
Entry
B737_7843         CDS       T02804                                 

Gene name
sfcA
Definition
(GenBank) malic enzyme
  KO
K00027  malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
amz  Amycolatopsis mediterranei RB
Pathway
amz00620  Pyruvate metabolism
amz01200  Carbon metabolism
amz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:amz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B737_7843 (sfcA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B737_7843 (sfcA)
Enzymes [BR:amz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.38  malate dehydrogenase (oxaloacetate-decarboxylating)
     B737_7843 (sfcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: malic Malic_M ELFV_dehydrog ThiF NAD_binding_8 Pyr_redox_3 Pyr_redox_2 DAO Pyr_redox FAD_binding_3 Shikimate_DH HI0933_like
Motif
Other DBs
NCBI-ProteinID: AGT88504
Position
complement(8771596..8772777)
Genome map
AA seq 393 aa AA seqDB search
MTDPTGAVAPVTDEEIFTGHEGGKLSVAATRPISSPRDLSIAYTPGVAKVSRAIAEDAAK
AKRYTWADRLVVVVSDGTAVLGLGDIGASASLPVMEGKSVLFKTFGGLDSIPLVLDTTDV
DEIVETLVRLRPSFGAVNLEDVSAPRCFELEDKLKEALDCPVMHDDQHGTAIVTLAALRG
ANLVLDRAIADQRVVVSGAGAAGVACAKILQEAGIGDVTVLDSRGIIHTGRDGLNPVKER
LAATTNKAGLRGGLAEALEGADVFLGLSGATIDESLLGRMAGGGIVFALSNPDPEVHPDA
AARYASIVATGRSDFPNQINNVLAFPGVFRGALDSGARAITENMKLAAAEAIVSVAMDDL
GPDRIVPSPLDPRVAPEVAAAVAKAAEADGVTD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccccaccggcgccgtcgcgccggtcaccgacgaagagatcttcaccgggcac
gagggcggcaagctctcggtggcggccacccgcccgatttccagcccgcgtgacctttcg
atcgcgtacaccccgggtgtggcgaaggtgagccgcgcgatcgccgaggacgccgccaag
gccaagcgctacacgtgggcggaccggctggtcgtcgtggtcagcgacggaaccgcggtg
ctcggcctcggcgacatcggcgccagcgcgtcgctgccggtcatggagggcaagtcggtg
ctcttcaagaccttcggcgggctcgactcgatcccgctggtgctggacacgaccgacgtg
gacgagatcgtcgagacgctggtgcggctgcggccgtcgttcggggccgtcaacctggaa
gacgtctccgcgccgcggtgcttcgagctggaggacaagctcaaggaagcgctggactgc
ccggtcatgcacgacgaccagcacggcacggcgatcgtgacgctggccgcgctgcgcggc
gccaacctggtcctcgaccgggcgatcgccgaccagcgcgtggtcgtctccggcgccggc
gcggcgggcgtggcctgcgcgaagatcctccaggaagccggcatcggcgacgtcacggtg
ctcgactcccgcggcatcatccacaccggtcgcgatggcttgaacccggtcaaggagcgg
ctggccgcgacgacgaacaaggcgggcctgcgcggcgggctggcggaggcgctggaaggc
gcggacgtgttcctcggcctgtcgggcgcgacgatcgacgagtcgctgctgggccggatg
gcgggcggcggcatcgtgttcgcactgtccaacccggacccggaggtccacccggacgcg
gccgcgcggtacgcgtcgatcgtggccaccgggcgaagcgacttcccgaaccagatcaac
aacgtgctggcgttcccgggcgtcttccgcggtgcgctggattcgggtgcccgggcgatc
acggagaacatgaagctggcggccgccgaggcgatcgtgtcggtggcgatggacgacctg
ggcccggaccggatcgtcccgagcccgctcgacccgcgcgtggccccggaggtcgcggcc
gcggtggcgaaggcggcggaagccgacggcgtcacggactga

DBGET integrated database retrieval system