KEGG   Amycolatopsis mediterranei RB: B737_7969Help
Entry
B737_7969         CDS       T02804                                 

Definition
(GenBank) LmbE family protein
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
amz  Amycolatopsis mediterranei RB
Brite
KEGG Orthology (KO) [BR:amz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B737_7969
Enzymes [BR:amz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     B737_7969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: AGT88630
Position
complement(8908743..8909663)
Genome map
AA seq 306 aa AA seqDB search
MVDADELRNTANPRLRLMAVHAHPDDESSKGAATMARYAAEGHEVLVVTCTGGEAGSILN
PAMDRPEVLANMSEIRREEMARAAKILGVSQHWLGFVDSGLPEGDPLPPVPEGSFAVVPL
EESTEALVRVIREFRPHVITTYDENGGYPHPDHIRTHEVSMAAWDAAPDPARFPDAGEPW
QPLKLYYVHGFSRARMVLFDEALKEAGLESPYTEWLANWDPNRGDVMERVTTRVECSEYF
EVRDEALKAHATQIDPTSRWFAVPREMQREVWPTEEYELVKSLVDSTLPEDDLFAGIVGA
EEKVNT
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggtggacgccgacgagctgaggaacaccgccaacccgcgcctgcgcctgatggccgtg
cacgcgcacccggacgacgagtcgagcaagggcgccgccacgatggcgcgctacgccgcc
gaaggtcacgaggtgctggtcgtcacgtgcaccgggggcgaagcaggcagcatcctgaac
ccggccatggaccggcccgaggtgctggcgaacatgagcgaaatccgccgggaggagatg
gcccgggcggccaagatcctcggcgtgagccagcactggctgggcttcgtcgactccggc
ctgccggagggcgacccgctgccgccggtgccggaggggtcgttcgcggtcgtgccgctg
gaggagtccaccgaggcgctggtgcgtgtgatccgggagttccgcccgcacgtgatcacg
acctacgacgaaaacggcggctacccgcaccccgaccacatccgcacccacgaggtgtcg
atggcggcgtgggacgcggcgccggacccggcccgcttccccgacgccggcgagccgtgg
cagccgctgaagctgtactacgtgcacggcttctcgcgcgcccggatggtgctgttcgac
gaggcgctgaaggaggccgggctggagtcgccgtacaccgagtggctggcgaactgggac
ccgaaccggggcgatgtgatggagcgggtgacgacccgcgtcgagtgcagtgaatacttc
gaggtgcgggacgaggcgctgaaggcgcacgccacgcagatcgacccgaccagccgctgg
ttcgccgtgccccgcgagatgcagcgcgaggtctggccgaccgaggagtacgagctggtc
aagtcgctcgtcgacagcacattgccggaggacgacctgttcgccggcatcgtcggcgcc
gaggagaaggtgaacacatga

DBGET integrated database retrieval system