KEGG   Amycolatopsis mediterranei RB: B737_8939Help
Entry
B737_8939         CDS       T02804                                 

Gene name
ltaA
Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
amz  Amycolatopsis mediterranei RB
Pathway
amz00260  Glycine, serine and threonine metabolism
amz01100  Metabolic pathways
amz01110  Biosynthesis of secondary metabolites
amz01120  Microbial metabolism in diverse environments
amz01130  Biosynthesis of antibiotics
amz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B737_8939 (ltaA)
Enzymes [BR:amz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     B737_8939 (ltaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AGT89599
Position
9934046..9935068
Genome map
AA seq 340 aa AA seqDB search
MTFTPPVLDFRSDTVTRPDETMRAAMASAEVGDNVLERDPTVAELEERAAHVLGMQAALW
VPSGTMANLIALSLHLQRGDRFLATRGAHVLVNELGSAAWLAGGMPDILEHDGGPGRPSP
DTLAAAIGQPGPYFTLRTSLLCLENTHNAAGGAVTPPDEHAQLLSVAKEAGLTVHLDGAR
LWQAAVALEVPPAALTVGVDTVSACFSKGLGAPVGSVVAGSAAFVERARRMRQMLGGGVR
QGGVLAAACLIALDRIPDLAESHENARRLADGLREHGWPANTPDTNIVLAEVPDIPTALA
WLDSLGIRAVQMAGKVRFVTHRDLSATDVEEAVRRIKTGV
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgaccttcaccccgcccgtcctggatttccgctccgacaccgtgacccggccggacgaa
acgatgcgggcggcgatggcctccgccgaagtcggggacaacgtcctcgagcgcgatccc
acggtcgcggagctggaggagcgcgcggcgcacgtcctgggcatgcaggccgcgctctgg
gtgccgagcgggacgatggccaacctgatcgcgctgagcctgcacctgcagcgcggcgac
cggttcctcgccacccggggcgcgcacgtgctggtcaacgagctgggctcggcggcgtgg
ctggccggcggcatgccggacatcctcgagcacgacggcggcccgggccgcccgtcgccc
gacacgctcgcggccgcgatcggacagcccgggccgtacttcacattgcggacatcgctg
ctgtgcctcgagaacacccacaacgcggccggcggcgcggtgaccccgcccgacgagcac
gcccagctgctgtccgtcgccaaggaagcgggcctgaccgtgcacctcgacggcgcccgg
ctgtggcaggccgcggtcgccctcgaagtgccgccggccgcgctgaccgtcggcgtcgac
accgtgtccgcctgtttcagcaagggcctcggcgcgccggtcggctcggtcgtcgcgggc
agcgcggcgttcgtcgagcgggcccgccggatgcggcagatgctgggcggcggcgtccgg
cagggcggtgtcctggccgcggcctgcctgatcgcgctggaccgcatccccgacctggcc
gagtcgcacgagaacgcccggcggctcgccgacggcctccgcgagcacggctggccggcc
aacacgcccgacaccaacatcgtgctcgccgaagtgcccgacatcccgaccgcgctcgcc
tggctcgactcgctcggcatccgggcggtgcagatggcgggcaaggtccggttcgtgacc
caccgggacctgagtgcgaccgacgtcgaagaagccgtacgccggatcaagaccggcgtc
tga

DBGET integrated database retrieval system