KEGG   Nostoc sp. PCC 7120: all0410Help
Entry
all0410           CDS       T00069                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana00260  Glycine, serine and threonine metabolism
ana00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ana01100  Metabolic pathways
ana01110  Biosynthesis of secondary metabolites
ana01130  Biosynthesis of antibiotics
ana01230  Biosynthesis of amino acids
Module
ana_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    all0410 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    all0410 (trpB)
Enzymes [BR:ana01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     all0410 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF1971
Motif
Other DBs
NCBI-ProteinID: BAB72368
CyanoBase: all0410
CYORF: all0410
UniProt: Q8YZP7
Position
complement(480495..481724)
Genome map
AA seq 409 aa AA seqDB search
MVSTPEIKNQLARPDALGRFGKFGGKYVPETLMPALGELETAYQKYRDDASYQTELQNLL
RDYVGRPSPLYFAERLTEYYARPDGTGAQIYLKREDLNHTGAHKINNALAQVLLAKRIGK
QRVIAETGAGQHGVATATVCARFGLDCVIYMGIHDMERQALNVFRMKLMGAEVRPVEAGT
GTLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMIVRDFHAIIGKETRVQCQEKWGGL
PDILLACVGGGSNAIGLFHEFIDEPSIRLIGVEAAGEGVDTDKHAATLTLGRVGVLHGAM
SYLLQDEDGQVIEAHSISAGLDYPGVGPEHSYLKDIRRAEYYSVTDKQALDGFQQLSRLE
GIIPALETSHAIAYLETLCPQLNGSPRIVINCSGRGDKDVQTVAKVLNY
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtggtaagcactccagaaattaaaaaccaacttgcacgcccagatgcactaggcagattc
ggtaaattcggcggtaagtatgtacctgaaaccctgatgccagctttaggcgaattagaa
accgcttatcaaaaataccgtgacgatgccagctatcaaaccgaattacaaaacttactg
cgtgattatgtaggcagacctagcccattgtactttgctgaacgcctaacagaatattac
gccagaccagacggaactggtgcgcaaatttacttaaagcgtgaagatttaaatcataca
ggcgcacacaaaattaataacgctttggctcaagtattactcgccaaacgcataggtaaa
cagcgtgtcattgccgaaacaggggcaggtcaacacggtgtagcaactgcaactgtatgt
gcgcgttttgggttggattgtgtgatttacatgggcatccacgatatggaacgacaagcc
ctaaatgttttccgcatgaagttgatgggggcggaagttcgcccagtggaagcgggtaca
ggaaccctcaaagatgcaacatcagaagcaattcgagattgggtaacaaatgtagaaacc
acacattacatccttggttctgtggctggcccccatccctacccgatgattgtccgcgac
ttccacgccattatcggtaaagaaacccgcgtccagtgtcaagaaaaatggggaggactc
ccagatattctactggcttgtgtgggtggtggttccaatgccattggcttgttccacgag
tttatagatgagccttccatccgtctgattggtgtggaagccgccggcgaaggtgtagac
acagataaacacgctgccaccttgacactaggtagagttggagttttgcatggtgcaatg
agttacttattgcaagatgaggatggtcaagtcattgaagctcactcaattagtgctgga
ctagactatccgggtgtagggcctgagcatagttatttgaaagatataagacgcgctgaa
tattacagcgtgactgataaacaagctttagatggatttcaacaactctcccgactagaa
gggattatacccgcattagaaacatctcatgcgatcgcttacctagaaactctctgtccc
caactcaatggtagccctcgcattgtcatcaactgttctggcagaggtgataaagatgtg
caaaccgtcgccaaagtccttaattattaa

DBGET integrated database retrieval system