KEGG   Nostoc sp. PCC 7120: all1046
Entry
all1046           CDS       T00069                                 
Symbol
natA
Name
(GenBank) ATP-binding protein of ABC transporter
  KO
K11957  neutral amino acid transport system ATP-binding protein
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ana00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    all1046 (natA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ana02000]
    all1046 (natA)
Transporters [BR:ana02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Neutral amino acid transporter
    all1046 (natA)
SSDB
Motif
Pfam: ABC_tran BCA_ABC_TP_C AAA_21 SMC_N AAA_23 AAA_16 AAA_29 AAA_30 AAA_15 RsgA_GTPase Zeta_toxin AAA_22 AAA_28 Thymidylate_kin MMR_HSR1
Other DBs
NCBI-ProteinID: BAB73003
CyanoBase: all1046
UniProt: Q7A2H0
Position
complement(1217552..1218334)
AA seq 260 aa
MVNNQSPPLPLLAASGLCKSFGGIKAVQEARIEVAQGSITGLIGPNGAGKTTLFNLLSNF
IRPDKGRVIFDGEPIQQLQPHQIAQQGMVRTFQVARTLSRLSVLENMLLAAQKQTGENFW
QVQLQPQVVVKEEKQLQEQAMFLLESVGLAKKAYEYAGGLSGGQRKLLEMGRALMTNPKL
ILLDEPAAGVNPRLIDDICDRILTWNRQDGMTFLIIEHNMDVIMSLCDRVWVLAEGQNLA
DGTPAEIQTNSQVLEAYLGK
NT seq 783 nt   +upstreamnt  +downstreamnt
ttggtaaataaccagtcacccccacttcccctattagcagctagcggactttgcaagagt
tttggcggtattaaagctgttcaagaagcgagaatcgaagttgcacaaggcagtatcact
ggcttgattggccccaatggtgctggcaaaactaccttatttaacctactttcaaacttt
atccgcccagataaaggacgtgtcatttttgatggcgaacccattcaacagttacagccg
caccaaatcgcccaacagggtatggtacggacttttcaggtagcccggactctctccagg
ctgtcggtgttagaaaatatgctgctagccgcccaaaagcaaacaggggagaatttttgg
caggtacagttacaaccccaggtagttgttaaggaagagaagcagctgcaagaacaagca
atgtttttgctggaatcggtgggtttggctaagaaagcttatgaatatgctggtggcttg
tctggaggacaacgcaagctgctagaaatgggtagggctttgatgactaatcccaaattg
attttgttggatgaaccagcagccggagtcaaccccagattaattgatgatatttgcgat
cgcatcctcacctggaaccgtcaagatgggatgaccttcttgattatcgaacataacatg
gatgtgatcatgtccttgtgcgatcgtgtttgggtacttgctgaaggacaaaatttagct
gatggaactccagccgaaatccaaactaattcccaagttttagaggcgtatttaggcaaa
tag

DBGET integrated database retrieval system