KEGG   Nostoc sp. PCC 7120: all1284
Entry
all1284           CDS       T00069                                 
Name
(GenBank) permease protein of ABC transporter
  KO
K11956  neutral amino acid transport system permease protein
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ana00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    all1284
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ana02000]
    all1284
Transporters [BR:ana02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Neutral amino acid transporter
    all1284
SSDB
Motif
Pfam: BPD_transp_2
Other DBs
NCBI-ProteinID: BAB73241
CyanoBase: all1284
UniProt: Q8YXD0
Position
complement(1526847..1527713)
AA seq 288 aa
MDIQTIQLIVNGIAVGSIIALAAVGLTLTYGILRLSNFAHGDFLTLGAYLTFFVNTFGVN
IWLSMIVAVVGTVGVMLLSEKLLWSRMRSIRANSTTLIIISIGLALFLRNGIILIWGGRN
QNYNLPITPALDIFGVKVPQNQLLVLALAVLSIGALHYLLQNTKIGKAMRAVADDLDLAK
VSGIDVEQVIFWTWLIAGTVTSLGGSMYGLITAVRPNMGWFLILPLFASVILGGIGNPYG
AIAAAFIIGIVQEVSTPFLGSQYKQGVALLIMILVLLIRPKGLFKGTM
NT seq 867 nt   +upstreamnt  +downstreamnt
atggacatacaaacgattcaactgattgtcaatggtattgctgtaggtagtattatcgct
cttgcagctgtgggactgactttaacttatggaattttacggttgtctaattttgcccac
ggtgatttcttaactttaggggcttatctgactttttttgtcaacacttttggggtaaat
atttggttatcgatgatagtggcagtagtgggaacggtgggagtaatgttactgtcagaa
aaattgctatggtctagaatgcgctcgattcgagctaattccactactcttattattatc
tcaattgggctggcattattcctgcgtaacgggattattttaatttggggtggcaggaac
caaaattataatttacccatcacccccgccttagatattttcggagtgaaagtaccacaa
aatcaattgctggtgttggcattggcagtattatccatcggcgcactgcactacctctta
caaaacacaaaaattggtaaggcgatgcgtgctgttgctgacgatttggatttagccaag
gtttcaggtattgatgtagagcaagtaattttttggacttggctaattgccggcacagtc
acctctttaggtggcagtatgtatggcttaattacggcagtgcgtcccaatatgggttgg
ttcttgattctgccgctattcgcttctgtaatcttgggcggtattggcaacccttacggt
gcgatcgccgcagcttttatcattggtattgttcaagaagttagtacacccttcttaggt
tcccaatacaaacaaggtgtagccctactaatcatgattttggtgttgctcattcgtcct
aaaggtttatttaaaggcacgatgtga

DBGET integrated database retrieval system