KEGG   Nostoc sp. PCC 7120: all1368Help
Entry
all1368           CDS       T00069                                 

Definition
(GenBank) amidotransferase
  KO
K02501  imidazole glycerol-phosphate synthase subunit HisH [EC:4.3.2.10]
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana00340  Histidine metabolism
ana01100  Metabolic pathways
ana01110  Biosynthesis of secondary metabolites
ana01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ana00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    all1368
Enzymes [BR:ana01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.10  imidazole glycerol-phosphate synthase
     all1368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase GATase_3 SNO Peptidase_C26 HU-CCDC81_bac_1 DJ-1_PfpI Peptidase_S51
Motif
Other DBs
NCBI-ProteinID: BAB73325
CyanoBase: all1368
CYORF: all1368
UniProt: Q8YX49
Position
complement(1622251..1622886)
Genome map
AA seq 211 aa AA seqDB search
MPVVAVIDYEMGNLHSVCKGLEKAGATPIITHCHQELTKADAVILPGVGAFDPAVQSLRS
RDLEQPIKDTIASGKPFLGICLGLQILFESSAEGNQPGLGIIKGKVRRFVWEPGITIPHM
GWNQLELTQPKSILWEHLPPQPWVYFVHSYYVDPFEPQVRAATVTHGTQTVTAAIAHENL
MAVQFHPEKSSNIGLQILSNFVSQVREKIAA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgccagttgttgctgttatagattatgagatgggaaatttgcattctgtttgcaaagga
ttagaaaaagcgggggcgactcctataattactcattgtcatcaggaattaaccaaggct
gatgcagtcatattgccgggagtgggagcatttgacccagcagtacagagcttgcgatcg
cgtgatttagaacaaccaattaaagatacaatcgcttctggtaaacccttcttaggtatc
tgtttagggctgcaaattctttttgaatcgagtgcggaaggtaatcaaccaggactagga
attatcaagggaaaagtgcggcggtttgtttgggaaccaggaattacaattcctcacatg
ggttggaatcagttggaattaacccaaccaaaaagcattttgtgggagcatttgccaccc
caaccttgggtatattttgtgcattcctactatgttgacccatttgaacctcaagttcgt
gctgcaactgttactcacggtacgcaaaccgtcacggcagccattgcccatgaaaacctg
atggcagtacaatttcacccagaaaaatcgtcaaatattgggctgcaaatcctgtctaat
tttgtctctcaagtacgggaaaaaatagcagcataa

DBGET integrated database retrieval system