KEGG   Nostoc sp. PCC 7120: all1599Help
Entry
all1599           CDS       T00069                                 

Gene name
desC
Definition
(GenBank) delta-9 desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana01040  Biosynthesis of unsaturated fatty acids
ana01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    all1599 (desC)
Enzymes [BR:ana01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     all1599 (desC)
Lipid biosynthesis proteins [BR:ana01004]
 Desaturase
  First
   all1599 (desC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: BAB77965
CyanoBase: all1599
CYORF: all1599
UniProt: Q44502
Position
complement(1879629..1880447)
Genome map
AA seq 272 aa AA seqDB search
MTIATSTKPQINWVNTLFFLGLHIGALFAFIPSNFSWAAVGVALLLYWITGGLGITLGFH
RLVTHRSFQTPKWLEYFLVLCGTLACQGGPIEWVGTHRIHHLHSDTDPDPHDSNKGFWWS
HIGWLIYHSPSHADVPRFTKDIAEDPVYQFLQKYFIFIQIALGLLLLYLGGWSFVVWGVF
FRIVWVYHCTWLVNSATHKFGYRTYDAGDRSTNCWWVAVLVFGEGWHNNHHAFQYSARHG
LEWWEVDLTWMTVQLLQILGLATNVKLADKKQ
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgctacttcaactaaacctcaaatcaactgggtaaataccctatttttcctt
gggctacacatcggcgctttgtttgcctttatccctagtaacttcagctgggcggcagtt
ggtgtggctttattgctttactggatcactggtggtttgggtattaccttaggctttcat
cgccttgttacccaccgcagttttcagactcccaagtggttggaatattttctagtgctt
tgcgggactctcgcttgtcaaggagggccaatcgagtgggtcggtacacatcgcattcat
catttacattccgatactgatccagatccccatgattctaataaaggtttctggtggagc
catattggttggctaatttatcactctccctcccacgctgatgttcctcggttcaccaaa
gatattgccgaagacccagtctatcagtttttacagaaatatttcatttttatccagatt
gctctggggttgttgctgttatatctaggcgggtggtcttttgtggtctggggagttttc
tttcgcatcgtttgggtttaccactgtacttggttggtaaacagcgctacccataagttt
ggctaccgcacctatgatgctggtgacagatccactaactgttggtgggtagctgtccta
gtgtttggtgaaggttggcacaacaaccaccacgcttttcaatattcagctcgtcacggg
ttggaatggtgggaagttgatctgacttggatgacagtgcaattgctgcaaatactcggt
ttagcaactaatgtcaaactagcagacaaaaagcagtaa

DBGET integrated database retrieval system