KEGG   Nostoc sp. PCC 7120: all1681Help
Entry
all1681           CDS       T00069                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana00240  Pyrimidine metabolism
ana00250  Alanine, aspartate and glutamate metabolism
ana01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    all1681
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    all1681
Enzymes [BR:ana01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     all1681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace DUF4431
Motif
Other DBs
NCBI-ProteinID: BAB78047
CyanoBase: all1681
CYORF: all1681
UniProt: Q8YWD2
Position
complement(2004495..2005496)
Genome map
AA seq 333 aa AA seqDB search
MPTSTWNRHHVLSLADFTAAEYDIVLKTAASFQEVLSRRTKKVPALQGQVVANLFFEPST
RTRSSFELAAKRLSADTLNFAASTSSMTKGETILDTAKTYLAMGTDIMVIRHKEAGVPNA
IAQEMDRLGVRVSVLNAGDGQHEHPSQGLLDLFTICSLIDPANPRLELLQGKKIAIVGDI
LHSRVARSNIWSLIASGAQVHLAAPPTLLPKFFAEYIFGEETAPPGQLFIHWQLEPALQE
ADFVMTLRLQKERMTANLLPSLREYHQLFGITRAKLQLCQPNVKVLHPGPVNRGVEISSD
LMDDPEFSLIQSQVTSGVAVRMALLYLIGSGKT
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcctacttcgacttggaatcgtcaccacgtcctttctttagctgactttactgctgct
gaatacgatattgttttaaaaactgctgccagttttcaagaggtattatctcggcggaca
aagaaagtaccagctttgcagggacaggtggtggcaaatttgttttttgaaccatctacg
cgcactcggagtagttttgaacttgctgctaaacgcctcagtgcagatacgctaaacttt
gctgcgtctacttcttccatgaccaagggagagacaattctcgatacagcaaagacatat
ttggcaatgggtactgatattatggtgatccgccataaagaagcaggtgtaccaaatgcg
atcgctcaagaaatggatcgtttaggtgtacgtgttagtgtcctcaatgctggcgatggt
caacatgagcatccctcccaaggactactggatttatttactatttgtagtttaatcgac
ccggccaatcctagattagagcttttgcaagggaaaaagatcgcgatcgttggtgatatt
cttcattcccgtgtagcgcgatccaatatttggagtttaattgctagtggcgcgcaagtg
catctagccgcaccacctactttattacccaaattttttgctgagtatatctttggagaa
gaaacagcacctcctggacaattatttatccattggcaattagaaccagctttgcaagag
gctgattttgtcatgactttacgcttacaaaaagagcgtatgactgctaatttattacct
agtttgcgagaatatcatcaattgtttggcattacccgcgctaaattgcaactatgtcag
ccaaatgtcaaagttttacatcccggccctgttaaccgtggtgtagaaatcagttccgat
ttgatggatgatccagaatttagtttgattcagtcccaagttaccagtggcgtagcggta
cgcatggcattgttgtatttaataggtagtggtaagacttga

DBGET integrated database retrieval system