KEGG   Nostoc sp. PCC 7120: all2912
Entry
all2912           CDS       T00069                                 
Name
(GenBank) ATP-binding protein of branched-chain amino acid ABC transporter
  KO
K11958  neutral amino acid transport system ATP-binding protein
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ana00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    all2912
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ana02000]
    all2912
Transporters [BR:ana02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Neutral amino acid transporter
    all2912
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_23 AAA_22 AAA_16 Mg_chelatase AAA_27 AAA_18 AAA_33 RsgA_GTPase AAA_15 MukB AAA_14 AAA_13 AAA_24 AAA AAA_30 NB-ARC BCA_ABC_TP_C NACHT AAA_10 SbcC_Walker_B MMR_HSR1
Other DBs
NCBI-ProteinID: BAB74611
CyanoBase: all2912
UniProt: Q8YT15
Position
complement(3553788..3554531)
AA seq 247 aa
MSGSAQNFTPLLEVENVHAGYIKDVDILQGVNFRVESGELVTVIGPNGAGKSTLAKTIFG
LLTPHTGKITFKGKNIAGLKSNQIVRLGMCYVPQIANVFPSLSVEENLEMGAFIRNDSLQ
PLKDKIFAMFPRLSDRRRQRAGTLSGGERQMLAMGKALMLEPSLLVLDEPSAALSPILVT
QVFEQVKQINQEGTAIILVEQNARKALEMADRGYVLESGRDAISGPGQELLTDPKVAELY
LGAGKGH
NT seq 744 nt   +upstreamnt  +downstreamnt
atgtcaggttcagcacaaaattttactcctctgctagaagttgaaaacgtccatgcagga
tacatcaaagatgtagacatattgcagggggtgaattttcgagttgaatcaggggaacta
gtgacagtaattggccccaatggcgctggtaaatctaccttagcaaaaaccatttttgga
cttttgacaccccatacaggcaaaattacttttaaaggcaagaatattgctggacttaaa
tcgaatcaaattgtgcgcctgggaatgtgttacgtgccgcaaatcgccaatgtctttcca
tccctcagtgtagaagaaaatttagagatgggggcgtttatccgcaatgattccctgcaa
ccattgaaagacaaaatatttgctatgtttcctagattaagcgatcgccgtcgtcaacgc
gcaggcacactctccggcggagaacgtcagatgctggcaatgggcaaagctttaatgtta
gaacctagtttgctggtgttagatgaaccatctgctgccttatccccaattctagtaaca
caagtatttgagcaagttaaacaaatcaatcaagagggaacagcaattattttagttgaa
caaaacgcccgtaaagctttagaaatggcagaccgtggttatgtactagaatctggacgt
gatgccatatccggccccggacaagagttattaactgatcctaaagtagctgaattatac
ttaggcgcagggaaagggcattag

DBGET integrated database retrieval system