KEGG   Nostoc sp. PCC 7120: all3836Help
Entry
all3836           CDS       T00069                                 

Definition
(GenBank) glucose 1-dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana00030  Pentose phosphate pathway
ana01100  Metabolic pathways
ana01120  Microbial metabolism in diverse environments
ana01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ana00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    all3836
Enzymes [BR:ana01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     all3836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase THF_DHG_CYH_C Eno-Rase_NADH_b
Motif
Other DBs
NCBI-ProteinID: BAB75535
CyanoBase: all3836
CYORF: all3836
UniProt: Q8YQI7
Position
complement(4635042..4635851)
Genome map
AA seq 269 aa AA seqDB search
MNGLKGKNTLITGASSGIGQAIAIRLAQEGCNIAINYRKSPSGAEETEEMALQKACKNVE
ICGVKSLLVQGDVSQEEDVVEMVNTVIEEFGSLDILINNAGIQTECPSHEITAEDFDRVI
GVNLRGSYLCARETIKHLLTQNRSGVIINISSVHEIIPRPMYVSYSISKGGMENMTKTLA
LEYAHRGIRVNSVAPGATITPINEAWTDDPEKKAVVESHIPMRRAGTSEEMAAAVAFLAS
DEAAYITGQTLFVDGGLSLYADFREPWSA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaacgggttaaaaggtaaaaacactctgattacgggtgctagttctggtattgggcag
gcgatcgctatccgtctggctcaagaaggttgtaacattgctattaattaccgcaaaagt
ccctcaggtgcagaggaaactgaagaaatggctttgcagaaggcttgtaaaaatgttgaa
atttgcggtgttaagtctttgttagtacagggtgatgtttctcaggaagaagatgttgtc
gagatggtcaacactgtaattgaggagtttggtagtctcgatattctcatcaataacgcc
gggattcaaactgaatgtccatcccacgaaatcacagcagaagactttgatcgcgtaatt
ggagtcaatctgcggggttcttacttgtgcgcgcgtgaaactattaaacacctgctgact
caaaatcgttcaggggtaattattaatatttccagtgtccacgaaattatccctcgacca
atgtatgtcagctattccatcagtaaaggtggaatggaaaatatgaccaaaactctagct
ttggaatatgctcatcggggtattcgtgtcaattctgtagcgcctggagcgacaattaca
cctatcaatgaagcttggactgatgacccggaaaagaaagcagttgtagaaagtcatatt
cccatgaggcgtgctggtacttccgaggaaatggcggcagcagtagcatttttagcatca
gatgaagcagcatacatcacgggacaaactttgtttgtagatggtggtctgtcgctgtac
gctgactttagagaaccttggtcagcttga

DBGET integrated database retrieval system