KEGG   Nostoc sp. PCC 7120: all5136Help
Entry
all5136           CDS       T00069                                 

Gene name
moeA
Definition
(GenBank) molybdopterin biosynthesis protein
  KO
K03750  molybdopterin molybdotransferase [EC:2.10.1.1]
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana00790  Folate biosynthesis
ana01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ana00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    all5136 (moeA)
Enzymes [BR:ana01000]
 2. Transferases
  2.10  Transferring molybdenum- or tungsten-containing groups
   2.10.1  Molybdenumtransferases or tungstentransferases with sulfide groups as acceptors
    2.10.1.1  molybdopterin molybdotransferase
     all5136 (moeA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoeA_N MoCF_biosynth MoeA_C
Motif
Other DBs
NCBI-ProteinID: BAB76835
CyanoBase: all5136
CYORF: all5136
UniProt: Q44243
Position
complement(6131152..6132462)
Genome map
AA seq 436 aa AA seqDB search
MQNKLSCEVKRNPHTPKPLHPYTPMPSVRDTANIIFNLVPKLDSQQDTEIVDLWAANGRI
LATPVNSTLDFPHWDNSAMDGYAVRYEDVHNSNAEQPVSLEVVAEIPAGYQPKFTLQPGQ
AARIFTGAVMPSGGDTVVMQEKTRQENNRVFILTTPKPGEFVRLKAAYYQAGTQLLPANT
QLNAAEIAILAASQCPQVKVYRRPRVAIFSTGDELVTLDQPLQPGQIVDSNQYALAALVK
QNGAEPILFGIVKDNPTALGETISKAIANADIVISSGGVSVGDYDYVDQILASLGAKIHI
RSVEMRPGKPLTVATFPTPPAPIYLGLPGNPAAVLVTFWRFVQPVIRKLGGLAKGWEPVF
VKVRSHDELHSDGKRETYIWGSLHLVDGLYEFHKAGGSHSSGNLINLAQTNALAVLPLGE
TFISSGKDVLVLQLPI
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
attcaaaataaattgagttgtgaagtgaagagaaaccctcacacccctaaacccttacac
ccctacacccccatgccatcagtcagggatacagcaaatatcattttcaatttagtccca
aagctggatagtcaacaagatacagaaattgtcgatttatgggcagcaaatgggcgcatt
ttggccacacctgtaaatagcaccctagattttcctcattgggataattcagcgatggat
ggctatgcggtacgttatgaagatgtacacaactccaacgccgaacagccagttagccta
gaagttgttgcagaaattcccgcaggctatcaacccaaatttaccctacaaccaggacaa
gccgcccggatctttactggcgcagtcatgcccagtggtggtgatactgtagtcatgcaa
gagaagacacgccaagagaataaccgcgtcttcatcctcacaacaccaaaaccaggggaa
tttgtcaggctgaaagcagcttattaccaagccgggacacaattattaccagctaatacc
caattaaatgcagccgaaatcgctatattagccgcttctcaatgcccacaggtaaaagtt
tatcgccgtcctcgtgtagcaattttttccactggggatgaattagtaacacttgaccag
cctttacaaccagggcaaatagttgattctaatcagtatgccctagcagctttagtaaag
caaaatggtgcagaacctatattattcggcattgtcaaagacaacccaaccgcccttggg
gaaacaatcagcaaagccatagctaacgccgatatagtcatttcttccggtggcgtttcc
gttggtgattatgattacgttgaccaaattctagcttccttaggggctaaaattcacatc
cgttctgtagaaatgcgcccaggaaaacccctcactgtcgccaccttccctacaccccca
gcccccatttatttgggtttaccaggaaaccctgcggctgttttggtaacattttggcga
tttgtgcagccagtaattcggaaattagggggattagctaaaggttgggaaccagtattt
gtaaaagtgcgatcgcatgatgagttacactcagacggtaagcgtgaaacttatatttgg
ggaagtctgcatctagttgatggattatacgagtttcacaaagctggtggtagccatagt
tccggtaatttgattaatctagctcaaactaatgctttagctgttttaccactaggtgaa
acattcatttcatcaggaaaagatgtattggttttacaactaccaatttaa

DBGET integrated database retrieval system