KEGG   Nostoc sp. PCC 7120: alr0124
Entry
alr0124           CDS       T00069                                 
Name
(GenBank) leucine-rich-repeat protein
  KO
K13730  internalin A
Organism
ana  Nostoc sp. PCC 7120
SSDB
Motif
Pfam: LRR_8 LRR_4 COR Roc Ras LRR_1 LRR_6 LRR_9 LRR_5 Arf Gtr1_RagA MMR_HSR1 TniB MMR_HSR1_Xtn AAA_16
Other DBs
NCBI-ProteinID: BAB77648
CyanoBase: alr0124
CYORF: alr0124
UniProt: Q8Z0H2
Position
125676..129035
AA seq 1119 aa
MTQDELLVLIEQAATEGWRELDLSGQELTELPGEIGKLQQLESLILGKQVGGYEKVGYRI
FQKALGNNLKTLPIELLSLPNLRKLDISGNPLEGIPDVVMQILHLEELILIRVQLTEIPE
ALAKLTNLTQLILSDNQITEIPEALAKLTNLTQLNLSYNQITEIPEALAKLTNLTQLNLS
YNQITEIPEALAKLTNLTQLNLRGNQRTEIPEALAKLTNLTRLNLSYNQRTEIPEALAKL
TNLTQLILSDNQIKEIPETIAKLTNLTHLILSGNQIKEIPETIAKLTNLTQLGLDGNQIK
EIPEAIAKLTNLTQLGLDGNQIKEIPEAITKLTNLTHLILSGNQIKEIPETIAKLTNLTQ
LALSSNQITEIPEVLAQLTNLTQLFLSSNQITQIPEALAPLTNLTTLHLRVNQITQIPEA
IESLPKLELLDLRGNPLPISPEILGSVYQVGSVEEIFNYLRLLRSGEVRPLNEAKLLLVG
QGSVGKTSLIERLIHNKYDRNQPQTDGLKVETWNVQVNSKDIRLNVWDFGGQEIYHATHQ
FFLTKRSLYLLVCNCRTSEEENRIEYWLKLIESFGGQSPVIIVGNKKDEQPLDINRKALR
EKYPNIQAIIETSCQDNIGIDELRTAILQQVGNLKEVYDLLPLSWFEVKQQLESMSQDFI
TYSSYIGICYENKIPEEHNQEQLIDLLHRLGLVLNFREHPILRDTNVLKPNWVTEGIYAL
LSDENLKTKSKGIFTPADLTRVLNPERYPTKRHGYLIELMKEFELGFELACYPPQFLIAG
LLPKDQPDATELEGETLEFQYHYKVLPESIISRFIVNTHERIHNQIYWRSGVMLQYQQHN
EIYNIARIKADPEDKKIFIAISGRKETRRSFLAILRDVFQKIHKSLANLEITEWVPVPGY
PNHPPLDYQELLGLETMGILEYPIGKLKININIRQLLDGYESLESRRKLQKGDHDLDDRT
AYEDILDIAKLAVSRPIITKAEAKAVSENPQFTNNLQGANIANFANEVKDNASQQASNFN
QTSGANIAEIMQLINNLRQTVAQFPPEIRDDIIIDIDDVEVEIQKPEKERNTPKLKKRLA
ALLTAASVAAAPIASVVDFTNNVMELGSKLGIELIQPSP
NT seq 3360 nt   +upstreamnt  +downstreamnt
atgacccaagatgagttgttggtactaatagagcaagcggctactgagggttggcgagag
ttggacttgtcggggcaagagttgactgagttaccaggggaaattggtaaattgcagcag
cttgagtctttgattttgggaaagcaggttggaggttatgaaaaagtaggataccgcatt
ttccaaaaggctttaggcaacaatttaaaaacccttccaattgaactattgagtttgcct
aatttgcggaagttggatattagtggcaatcctttagagggtattcctgatgtggtaatg
caaatactacatttagaggaactaatcttaattcgagtacagctaaccgagataccagag
gcgcttgctaaattaaccaatctcactcagcttattctcagtgacaaccaaataaccgag
ataccagaggcgcttgctaaattaaccaatctcactcagcttaacctcagttacaaccaa
ataaccgagataccagaggcgcttgctaaattaaccaatctcactcagcttaacctcagt
tacaaccaaataaccgagataccagaggcgcttgctaaattaaccaatctcactcagctt
aacctccgtggcaaccaaagaaccgagataccagaggcgcttgctaaattaaccaatctc
actcggcttaacctcagttacaaccaaagaaccgagataccagaggcgcttgctaaatta
accaatctcactcagcttattctcagtgacaaccaaataaaagagataccagagacaatc
gctaaattaaccaatctgacgcatcttattctcagtggcaaccaaataaaagagatacca
gagacaatcgctaaattaaccaatctgacgcagcttggactcgatggcaaccaaataaaa
gagataccagaggcaatcgctaaattaaccaatctgacgcagcttggactcgatggcaac
caaataaaagagataccagaggcaatcactaaattaaccaatctgacgcatcttattctc
agtggcaaccaaataaaagagataccagagacaatcgctaaattaaccaatctgacgcag
ctcgccctcagttccaaccaaataaccgagataccagaggtgctggcacaattaaccaat
ctcacccagcttttcctcagttccaaccaaataacgcagattccagaagcgctggcacca
ttaaccaatctgactacccttcacctgcgtgtcaaccaaataacccagataccagaggcg
atcgaaagtttgccaaaattggaactactagatttacggggaaatccgcttcctatttca
ccagaaattttgggatctgtttatcaagttggttcagttgaagaaattttcaattacttg
cgattacttcgtagcggtgaagtacgtccactcaacgaagccaaacttttgctcgtcgga
caaggtagcgtcggtaaaacatccctcatcgagcgactaatccacaataaatatgataga
aatcaaccccaaactgacggactcaaggtagaaacttggaacgtgcaggtcaatagcaaa
gacatccgccttaatgtttgggactttggcggacaggaaatttatcatgccacccatcag
tttttcctgactaagcgcagcctctatcttcttgtttgtaattgtcgcaccagcgaagaa
gaaaaccgcatcgaatattggctgaaactaatcgaaagcttcggcggacagtcccccgtg
attatcgttggcaacaaaaaagacgaacaacccctagacatcaaccgcaaagcattacga
gaaaaatatcctaacatccaagcgattatcgaaacctcttgccaagacaatatcggcatt
gatgaacttcgcaccgcgattttgcagcaagtcggcaacctcaaagaagtctacgacctt
ctacccctgtcatggtttgaggttaaacaacaactcgaatccatgtcccaagacttcatt
acctacagtagctatatcggcatctgctacgaaaataaaattcccgaagaacacaaccaa
gaacaactcatcgacttgctgcatcgacttggcttagttctcaacttccgtgagcatccc
atcctcagagataccaacgtcctcaaacccaattgggtgacagaagggatttacgccctt
ctgagcgatgaaaacctcaaaactaaaagcaaaggcattttcacccccgccgatctcact
cgtgtcctcaatccagagcgttaccctaccaagcgtcacggctatctgattgaactgatg
aaagaatttgagcttggctttgaattagcttgttacccaccacaattcctgattgcggga
cttctccccaaagaccaaccagacgcaacagaactagaaggcgaaaccctagaatttcaa
taccattacaaagttcttcccgaaagcataatttcccgcttcatcgtcaacacccacgaa
agaatccataaccaaatctattggcgcagtggcgtaatgctgcaatatcaacaacataat
gaaatttacaacatcgctcgcatcaaagccgaccccgaagacaaaaaaatcttcatcgcc
attagcggacgcaaagaaacccgccgttcatttctcgccattctccgcgatgtcttccaa
aaaatccacaagagtcttgccaacctcgaaatcaccgaatgggttcccgtccctggctat
cctaaccacccgcccctcgactaccaagaacttctgggacttgagacaatgggtattctt
gaatatccaatcggtaaactcaaaataaacatcaatatccgtcaacttttggatggttat
gaatcactagaatcacgtcgaaaattacaaaaaggagatcatgatttagatgataggact
gcttatgaagatatcttagatattgctaaactagccgtcagtagaccaattattactaaa
gctgaggcaaaagctgtgtcagaaaatcctcaattcacaaacaaccttcaaggcgcaaac
atcgccaatttcgccaacgaagtcaaagacaacgccagtcagcaagcctctaacttcaac
caaacaagcggcgcaaacatagcagaaataatgcaattaatcaacaacctacgccaaact
gtagcccagttccccccagaaatccgcgacgatattattattgatattgatgatgtagaa
gtagaaattcaaaagccagaaaaagaacgcaatacacccaaacttaaaaagcgtctagca
gctttactaactgctgctagtgtagctgctgccccgatcgcaagtgtggtagattttaca
aacaatgttatggaactcggcagcaaattaggcatagagctaattcagcctagtccttga

DBGET integrated database retrieval system