KEGG   Nostoc sp. PCC 7120: alr0188Help
Entry
alr0188           CDS       T00069                                 

Definition
(GenBank) GDP-mannose pyrophosphorylase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana00051  Fructose and mannose metabolism
ana00520  Amino sugar and nucleotide sugar metabolism
ana01100  Metabolic pathways
ana01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ana00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    alr0188
   00520 Amino sugar and nucleotide sugar metabolism
    alr0188
Enzymes [BR:ana01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     alr0188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 MannoseP_isomer
Motif
Other DBs
NCBI-ProteinID: BAB77712
CyanoBase: alr0188
CYORF: alr0188
UniProt: Q8Z0B0
Position
202511..203587
Genome map
AA seq 358 aa AA seqDB search
MYDNMSSPLFPVILAGGKGERFWPLSRQDRPKQFLSLDGSSRSLLQSTAERLVKFAGEWN
DLWVITSSQLGQGVQQQLPELPSQNLLTEPQGRDTAAAVAWASLEIQKRYGDDAIIGFFP
SDHWIADPEAFKRTLDAASQLATSTEAIVTLGIKPTFPSTGYGYIEQGEKIGTFNELPAY
HVNRFTEKPIREKAESFLSTGRYSWNSGMFVFRAGVVLKELYTYAPEIIEPLVKHGVDVY
PQLPKQSIDYALMEKTNLVYVLPADFGWDDLGDWNAIERLLKKPDNPNVELATHVGLDTQ
GAIVYATNPEDVIVTIGLEDVVIVRDRNVTLIVNKERTQEIKQILKTLQSDPRFTDLL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtgtatgacaacatgagtagcccattgttcccagtaatcctggctggtggtaaaggcgaa
cgtttttggcctcttagccgccaagatcgacccaaacaatttttaagtcttgatggtagc
tccagaagtctattgcaatcaaccgccgagcgactggttaagttcgcaggcgagtggaat
gacctatgggtaatcacctctagtcagttaggacaaggggtgcaacaacaactacccgaa
ttaccatcgcaaaatttgttgactgagccgcagggtagagacacggctgcggccgttgct
tgggccagtttggaaattcaaaagcgttatggtgatgacgcgattataggcttttttccc
tccgatcactggatagctgatccggaggcgtttaaacgcactttagatgctgctagccaa
ttagcgacaagcacagaggcaattgtcactttggggatcaaaccgactttcccatcaact
ggttacggctacattgaacaaggagaaaaaattggtacctttaatgagttgccagcttat
catgtcaatcgctttactgaaaagcctatccgggaaaaagccgaaagttttctgtctacg
ggacgatatagctggaatagcggtatgtttgttttccgagccggagttgttcttaaggaa
ctctatacctatgcgccagaaatcattgaaccacttgtaaaacatggggttgatgtttat
ccccagttacctaaacagagtatagactacgcactcatggaaaagacaaatctagtatat
gtcttaccagcagattttgggtgggatgatttaggagattggaatgcgatcgagcgttta
ctaaaaaaacctgataatcctaatgtagaactagctactcatgtgggtctagatactcag
ggggcgattgtttatgcgactaatccagaggatgtaattgttactattggtttagaggat
gtagtgattgtgcgcgatcgcaatgttactctcatagtcaataaggaacgtacccaggaa
atcaaacaaatcctcaaaaccttacaaagcgatccccgatttactgacctactctaa

DBGET integrated database retrieval system