KEGG   Nostoc sp. PCC 7120: alr1004Help
Entry
alr1004           CDS       T00069                                 

Definition
(GenBank) alanine--glyoxylate aminotransferase
  KO
K00830  alanine-glyoxylate transaminase / serine-glyoxylate transaminase / serine-pyruvate transaminase [EC:2.6.1.44 2.6.1.45 2.6.1.51]
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana00250  Alanine, aspartate and glutamate metabolism
ana00260  Glycine, serine and threonine metabolism
ana00630  Glyoxylate and dicarboxylate metabolism
ana00680  Methane metabolism
ana01100  Metabolic pathways
ana01110  Biosynthesis of secondary metabolites
ana01120  Microbial metabolism in diverse environments
ana01130  Biosynthesis of antibiotics
ana01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ana00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    alr1004
  09102 Energy metabolism
   00680 Methane metabolism
    alr1004
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    alr1004
   00260 Glycine, serine and threonine metabolism
    alr1004
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ana01007]
    alr1004
Enzymes [BR:ana01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.44  alanine---glyoxylate transaminase
     alr1004
    2.6.1.45  serine---glyoxylate transaminase
     alr1004
    2.6.1.51  serine---pyruvate transaminase
     alr1004
Amino acid related enzymes [BR:ana01007]
 Aminotransferase (transaminase)
  Class V
   alr1004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: BAB72961
CyanoBase: alr1004
CYORF: alr1004
UniProt: Q8YY48
Structure
PDB: 

Position
1175265..1176410
Genome map
AA seq 381 aa AA seqDB search
MAQIISINDNQRLQLEPLEVPSRLLLGPGPSNAHPSVLQAMNVSPVGHLDPAFLALMDEI
QSLLRYVWQTENPLTIAVSGTGTAAMEATIANAVEPGDVVLIGVAGYFGNRLVDMAGRYG
ADVRTISKPWGEVFSLEELRTALETHRPAILALVHAETSTGARQPLEGVGELCREFGTLL
LVDTVTSLGGVPIFLDAWGVDLAYSCSQKGLGCSPGASPFTMSSRAIEKLQRRRTKVANW
YLDMNLLGKYWGSERVYHHTAPINLYYALREALRLIAQEGLANCWQRHQKNVEYLWERLE
DIGLSLHVEKEYRLPTLTTVCIPDGVDGKAVARRLLNEHNIEVGGGLGELAGKVWRVGLM
GFNSRKESVDQLIPALEQVLR
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagataatctcaatcaatgacaatcaacgtttacaactagaacctctagaagtt
ccctcccgtttgctgttgggtcctgggccatcaaacgcccatccctcagtcctgcaagca
atgaatgtttcaccagtaggacatcttgacccagctttcctcgcactgatggatgaaatt
caatctttgctgcgctacgtatggcaaacggaaaatcccctcacaattgctgtgagtggt
acagggacagctgcaatggaagcaaccatcgctaatgctgtagaaccaggtgatgtagtg
ttaattggtgttgctggttattttggtaatcgtctggtggatatggctggacgctatggc
gcagatgtccgcacaatttccaaaccttggggagaagttttctcactggaagaactccgc
acagctttagaaacccatcgtccggcaattttggctttagttcatgcggaaacttccaca
ggcgcacgtcaacccttggaaggtgtgggtgagttgtgccgagaatttggcactctgcta
ttagtagatacagttactagcttgggtggtgtccctatctttttggatgcttggggagtg
gatttagcctacagttgcagtcagaaaggtttaggttgttctcctggcgcttcgcctttt
accatgagttcccgtgctatcgaaaagttgcaacggcgacgcactaaagtggcgaactgg
tatttagatatgaacttgttgggtaagtattggggtagtgaacgggtttatcaccataca
gccccgattaatttgtattatgctttacgggaagcgttacgtttaattgctcaggaagga
ctagcaaactgctggcaacgccatcaaaagaacgtagagtatttgtgggaaagattagaa
gatataggcttaagtctgcacgttgagaaggaatacagactaccaaccctgaccacagtc
tgtattccggacggagtggatggtaaagcagtcgcccgtcggttactcaatgaacataac
attgaagtaggcggtggtttaggtgaattagccggtaaagtctggcgtgtgggactaatg
ggtttcaatagccgcaaagaaagcgttgaccaattgattccagccttagagcaagtttta
cgttag

DBGET integrated database retrieval system