KEGG   Nostoc sp. PCC 7120: alr1834
Entry
alr1834           CDS       T00069                                 
Name
(GenBank) probable periplasmic branched chain amino acid binding protein
  KO
K11954  neutral amino acid transport system substrate-binding protein
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ana00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    alr1834
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ana02000]
    alr1834
Transporters [BR:ana02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Neutral amino acid transporter
    alr1834
SSDB
Motif
Pfam: ANF_receptor Peripla_BP_6 Peripla_BP_5 LppC
Other DBs
NCBI-ProteinID: BAB73533
CyanoBase: alr1834
UniProt: Q8YVY4
Position
2199462..2200787
AA seq 441 aa
MQRISAALSLGLATFTAGFLLAACETSNTTPNGAANNGATSTPATDTTATSGGSGLKIGS
LLPATGDLASIGQQMAAAVPLVVETVNACGGVNGQPVSLVAVDDQTDPKAGAAGMTKLAT
VDKVAGVVGSFASSVSTAAVSIAAQNKVLLISPGSTSPVFTEKAQKGDFNGFWARTVPPD
SYQGPALAELANKKGFKRVSTIVINNDYGVGFEKAFVQAFEKLGGTVVNKNNPVRYDPKA
TTFETEAAAAFAGKPDAVLGVFYVETGSLLLKSAYQQGVAQGVQIMLTDGMKSDEFPAQV
GKTADGKFIASGIIGTVPGSDGKGLEALTKLWQSKKGSAPGEFAPQAWDATALLVLAAQA
AKENTGVGIAGKIRDVSSAPGVEVTDVCEGLKLLQEGKDINYQGASGNVDIDANGDVIGV
YDVWTVGDDGKIKTIDKVTPK
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgcaaagaattagtgctgccctcagtttaggtttagctaccttcaccgcaggttttctt
ttagcagcttgtgaaacaagtaataccacacctaatggcgcagctaacaatggcgcaact
agtaccccagccacagacaccactgcgaccagtggtgggtcagggctaaaaattggttct
ctcctgccagcaacaggcgatttagcatctattggacaacaaatggctgcggctgttccc
ttagtagtagaaacagtcaacgcttgcggcggtgtgaatggtcaacctgttagcctagtg
gctgtagacgaccaaacagacccgaaagcaggcgcggctggtatgactaaactagcaact
gtagataaggttgcgggtgtagtcggctcttttgctagcagcgtttccacagctgccgtc
tccattgcggcccaaaataaagtcttactaatttcccctggtagtaccagtcccgtattt
accgaaaaagcgcagaaaggcgactttaatggcttttgggcgcggacagttccccctgat
agctatcaaggcccagccttagccgaacttgccaacaagaaaggctttaagcgagtttcc
accattgtgattaacaatgactatggagtgggttttgaaaaagcatttgtccaagctttt
gaaaaactcggtgggactgtagttaacaaaaataatcctgtacgctacgaccccaaagca
accacctttgaaaccgaagcggcggcggcctttgctggtaagccagatgcagttcttggt
gttttttacgtagaaacaggtagcttactactaaaatcagcctatcagcaaggtgtggct
caaggtgtacaaatcatgctgacagatggcatgaaatccgatgagtttccggcgcaagtc
ggtaaaactgctgatggtaaatttatcgcctctggcatcattggcacagttcctggttcc
gatggtaaaggattagaagccttaacaaagctttggcaatcgaaaaaaggcagtgcgcca
ggagaattcgcaccccaagcatgggacgcgacagccttgttagtgttggcagcccaagcc
gccaaggaaaatactggtgtgggtattgctggtaaaatccgtgatgtatctagtgcgcct
ggtgtagaagttactgatgtttgtgaagggctaaagttactccaggagggcaaagatatc
aactatcaaggagctagtggtaacgttgatattgatgcaaatggtgatgtcatcggtgtc
tatgatgtgtggacagtaggcgacgatggcaagattaagactattgacaaagtgactcct
aagtag

DBGET integrated database retrieval system