KEGG   Nostoc sp. PCC 7120: alr2338
Entry
alr2338           CDS       T00069                                 
Name
(GenBank) hypothetical protein
Organism
ana  Nostoc sp. PCC 7120
SSDB
Motif
Pfam: EamA Baculo_PEP_C Dynamin_M IL32 Bac_GDH
Other DBs
NCBI-ProteinID: BAB74037
CyanoBase: alr2338
UniProt: Q8YUK6
Position
2818434..2820689
AA seq 751 aa
MGRFEKRPDNDPRVRGELSRAAETALWAVVEDLESLQQNVLRSFQEEIKKLQTEKDRLTD
EVQQLIEEKEHLQEVRRITEQQVLIRQLSEALAKHICSQLQSSLAKIANQTESQIAALKS
AQSIGPAIENNEQVEKMLGSLDDNLTIAFNSLQQELKNYQSNLSQQLSRMYNQQQQGETI
VEELIDRLRGELTRAIQETSTAKAQLSPPTVLQPPELQPPSSPVVVNLSPPTVLQFPDQQ
SPNPLQASTPLEETSTTKPSVSITPPEKSTPVTIVPPPQETRPETKSVIPKVSPDSETKL
QSSQEKAAEPSSVINRELSAGAAKSPLTPEKPPEPISTSKTKFSPSSEKPPEPISTSKTK
FSPSSEKPPEPVSVLSRDSSASKASTPPPAPVVRRGSTPSSSRSRKSSNLSPVQVGFLLV
VLSTVMTALYNVVLKGMFYKTSQLSAMLEVAGLISPTLGNIMLILTLRLMVVVPLMILLA
PMMYPQVWQDLQNLKQSLGNNQSGSRSQPQRFVQLMFASGCFLFLSQVLIYLAIGQVPTG
VAIALFFVYPLINGVLSWLLFRDRPGVFRASAIGAIFCGEVLVFAGATSTGIGTTPLGSI
TAILAGAAFACYLILTRVCAAKVHPVSLSLINFVTMLGLSFIFLMIPLPENWSLVVDPSK
LLEIVLSAFILGALTLLSYVFSHIGINKLGGLRSAIISASVPILTVILAGLVLQETLNIA
QIFGVLFVTFGAIAFGIGKIQNPNKPANAEG
NT seq 2256 nt   +upstreamnt  +downstreamnt
atggggcgatttgagaagcgaccagacaacgacccgcgagtccgaggcgagttatccagg
gcagcagaaacagctctatgggctgttgtggaagatttagaaagtctacagcagaatgtc
ctcagatcatttcaggaagaaatcaaaaaactacagacagaaaaagaccgtttaacagat
gaagttcagcagctaattgaagaaaaagaacatttacaagaggtacggcggattacagag
cagcaagtattaatccgtcaattgtcagaagctttagccaagcacatctgttctcaattg
caatcatcactagcgaaaatagccaaccaaacagagagccaaatagctgctctcaagtca
gcccaaagcatcggccctgctatcgagaacaatgagcaggtagaaaaaatgctgggtagt
ctagacgataacctgacgatcgcctttaattctctccaacaagaactcaaaaactaccaa
agtaatctctcccagcagttgtctcgaatgtataaccaacagcagcaaggagaaacaatt
gtcgaagagttaattgatcgtctacgtggggaattgacaagagctatccaagaaacatca
acagcgaaagctcagttatccccgccaacggtgttgcagcctccagaactacaaccccca
agctctccggtggtagtgaatttatcaccacctacggtattgcaatttcctgatcaacaa
tcgcccaatcctttacaagcatctacaccattagaggagactagcactaccaagccatcg
gttagtattactcctcctgagaaatcaacaccagtaacaatagttccaccaccccaggaa
acacgaccagaaacaaagtctgtcatccccaaggtgtcaccagacagcgagacgaaatta
caatcatctcaggaaaaagctgctgaaccaagttctgtaattaacagagaattatctgcg
ggtgcggctaaatctccactaactccagaaaaacctcctgagccaatttctacaagtaaa
acgaagttctcaccctcctcagaaaaacctcctgagccgatttctacaagtaaaactaag
ttctcaccctcctcagaaaaacctcctgagccagtttctgtactcagtcgagattcatcg
gcaagtaaagcttcaactcctccgcctgcaccagtagtcagacggggatcaacaccttcc
tcatcaagatcacgtaaatcatctaacttgtcaccagtccaagtgggttttttgttggta
gtgttgtccacggtgatgacagcgttatacaacgtagtcctgaaggggatgttctataaa
acttctcaactctccgcaatgctggaagtggcggggttaatctcgccgaccttgggaaat
attatgttaattctgactttgcggttaatggtggttgtaccactaatgatacttttagca
cccatgatgtatccgcaagtgtggcaggatttgcaaaacctgaagcaatcattaggcaat
aatcagtctggaagtcgttctcagccacagagatttgtccagttaatgtttgctagtggc
tgctttttgtttttatcgcaagttctgatttatctggccattggtcaagtccccaccgga
gtggcgatcgcccttttctttgtctatccactgatcaacggggtgttatcctggcttctg
ttccgcgatcgccccggtgtatttcgcgctagtgcgatcggcgctattttctgtggtgag
gtgctagtttttgcgggagcaaccagcactggtataggaactactccccttggtagcatc
accgcaattcttgctggtgcagcctttgcttgttacctcatcctgacccgcgtatgtgcg
gctaaagtccatccagtatctttgtctttgattaacttcgtcaccatgttggggttgagt
tttatcttcttgatgataccgttaccggaaaactggagcttagttgttgacccttctaag
ttactggaaattgtgttaagtgcttttattttgggtgctttaactctattgagctatgta
tttagccatattgggatcaataaattaggtgggttgcggtcagctattattagtgcaagt
gtacctattttgacagtaattcttgctggtttggtacttcaagaaactttaaacattgcc
caaatattcggagttttattcgtcacttttggggcaattgcttttggtattggcaaaata
caaaatcccaacaaacctgccaatgcagaaggttaa

DBGET integrated database retrieval system