KEGG   Nostoc sp. PCC 7120: alr3026
Entry
alr3026           CDS       T00069                                 
Name
(GenBank) hypothetical protein
Organism
ana  Nostoc sp. PCC 7120
SSDB
Motif
Pfam: DctQ DUF6141 DUF4013
Other DBs
NCBI-ProteinID: BAB74725
CyanoBase: alr3026
UniProt: Q8YSQ8
Position
3666133..3666687
AA seq 184 aa
MEKLLKISRIIDAFTERIGRYTSWLVLVMVILGVWNVVGRYLGRISGNNLTSNAYIEAQW
YIFDVIFFLGAAYTLKHNEHVRVDIFYSNWQRRRKAIADFLGTIFFLIPFSIIVIFVSWE
TIVASWQIGELSPDPGGLPRYPIKAMIIVGFVLLIIQGISQAIKNLAIIQGRLEPQEENH
DTGL
NT seq 555 nt   +upstreamnt  +downstreamnt
ttggaaaaattgttgaaaatatcgagaataattgatgcctttacagaacgcataggtcga
tataccagttggttggtgttagtcatggtcatactaggcgtgtggaatgttgtcgggcga
tatttaggccgcattagcggtaacaacctcacatccaacgcttatatagaagctcaatgg
tatatttttgatgtaattttcttcttaggggctgcttataccctgaagcataatgaacac
gtccgcgttgatattttttatagtaattggcaacgtcggcgtaaagcgatcgccgacttt
ctcggaaccatattttttctcattcctttcagcatcatagtgatttttgtttcttgggaa
accattgtcgcatcatggcagattggtgaattatcacccgatccaggtgggttgccccgc
taccccattaaagccatgattatcgttggctttgtgttgttaattattcaaggaatttcc
caagcaattaaaaatttagcaattatccaaggcagactagaaccccaggaggaaaatcat
gacactggcttatga

DBGET integrated database retrieval system