KEGG   Nostoc sp. PCC 7120: alr3056Help
Entry
alr3056           CDS       T00069                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana00340  Histidine metabolism
ana01100  Metabolic pathways
ana01110  Biosynthesis of secondary metabolites
ana01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    alr3056 (hisD)
Enzymes [BR:ana01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     alr3056 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: BAB74755
CyanoBase: alr3056
CYORF: alr3056
UniProt: Q8YSM8
Position
3701406..3702701
Genome map
AA seq 431 aa AA seqDB search
MLVLKTTDKEFSPRFQSLVSDRREATVDVSGTVRDILAHVKARGDAAVQEYTSRFDHYRP
HSHHLSAAFIAEQAAKCSDEVKAALELAAERISSFHQKQLPQDIGYTDTAGVKLGLNWVA
LSQVGIYVPGGRASYPSSVLMNALPAKIAGVERIVMTVPMPHGEINPAVLAAAQVAGVTE
IYSIGGAQAVGALAYGTETITPVDKIVGPGNAYVAEAKRQVFGTVGIDSIAGPSEILVVA
DRQNNPEWIAWDLLSQAEHDPSAQSILITDSESFAQQVIAAVEQILTTLPSQKVASSSWQ
NHGAVIIVRDLAESIPLLNQLAPEHVELCVDNPQLLASQIKCAGSLFLGRYTPEAIGDYL
GGPNHVLPTSRSARFASGLSVYDFLKRITYLECNQAALQKIGQSAVTLAETEGLPAHAGS
VAVRLQGLKDM
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgctagtcttgaaaacaaccgacaaagaattttctcccagattccaaagcttggtgagc
gatcgccgagaagcaacggttgatgttagtggtacagtacgcgatatactcgctcatgta
aaagcgcgtggtgatgccgcagtccaggaatataccagtcgttttgatcactatagaccc
cattctcatcatttaagtgcggctttcattgccgaacaagcagcgaaatgttcagatgag
gtaaaagcagccttagaactagcggctgaacgtattagttcttttcatcaaaaacaatta
ccccaagatattggttacaccgataccgcaggcgtaaaactgggcttaaattgggtagct
ttatcgcaagtgggaatttatgtccctggcggacgcgccagttaccccagttcggtcttg
atgaatgccctacccgccaaaattgcaggtgtagaacgcatcgttatgactgtgcctatg
cctcatggggaaatcaatcccgccgttctggctgctgcccaagtcgccggcgtaacagaa
atatatagtataggtggagcgcaagcagtcggggcgttagcctacggtacagaaactatc
acccccgtagataaaattgtcgggcctggtaatgcctacgttgctgaagccaaacgccaa
gtatttgggactgtgggtattgacagcatcgccgggccttcggaaattttagttgtcgcc
gatcgccaaaacaatccagaatggatcgcctgggatttattatcccaagctgaacacgat
cccagcgctcaatcaattttaattactgactctgaatcctttgcccaacaagtgattgcg
gcggtagagcaaatcctcactaccttacccagtcaaaaagtagccagtagtagttggcaa
aatcatggggcagtgattattgttagggatttagccgaaagtatccctttactcaatcaa
ctagctccagaacacgtagaactgtgtgtagataaccctcaattgctagctagtcaaatt
aagtgtgctggtagtttatttttaggtcgttatactccagaggcgatcggtgattattta
ggtggccccaatcacgtattacctacttcccgttctgcccgctttgcttccggcttaagt
gtctacgattttctcaagcgcattacctatttagaatgcaatcaagcggcattgcagaaa
ataggccagtccgccgtcactcttgcagaaactgagggtttaccagctcatgcaggtagt
gtagcggtgcgtttgcaagggctgaaagatatgtag

DBGET integrated database retrieval system