KEGG   Nostoc sp. PCC 7120: alr3187
Entry
alr3187           CDS       T00069                                 

Definition
(GenBank) glutamine-binding periplasmic protein of glutamine ABC transporter
  KO
K17062  arginine/lysine/histidine/glutamine transport system substrate-binding and permease protein
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ana00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    alr3187
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ana02000]
    alr3187
Transporters [BR:ana02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Arginine/lysine/histidine/glutamine transporter
    alr3187
Motif
Pfam: SBP_bac_3 BPD_transp_1 Lig_chan-Glu_bd
Other DBs
NCBI-ProteinID: BAB74886
CyanoBase: alr3187
CYORF: alr3187
UniProt: Q8YSA2
Position
3856114..3857619
AA seq 501 aa
MSKRVFGRWCLVLSLICLFLTGCSGNLSQGKTLRIATEPAFPPFEFTAQGGNLQGFSIDL
MNAIASAANLKVNFQSLPFDGIIPALQSRTVDAAISSITITAERAETVAFSRPYFKAGLA
IAIRSSNEDITGFDSLKNKKIAVQIGTTGAGKAKSIPGAQIRSFDSAPLALQELLNNNVD
AVINDAPVTLYAINTGNLQGIKVVEKLLTEEYYGIATAQNSPYLALINDGLNRVLADGSY
SQIYQKWFKVEPPSLPDKSLYENQTNTHKSGSINLILQFLPTLLQGALVTIQLTILSTVL
GLICGTLIALTRLSQFTPARLFARAYVDFFRGTPLLVQIFMIYFGIPALAQQLGFTFNFD
RWVAGVIALSVNAAAYIAEIVRAGIQSIETGQTEAAKSLGLNPWLTMRLVIFPQAFRRML
PPLGNEFISLLKDTSLVAVIGFEELFRKGQLIVADNYRAFEIYAAVAIVYLCLTLLASQV
LSRLEMWMNPTMKAQQRKAKR
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgagtaagcgggtttttggacgttggtgtctggtgttgagcttaatttgtttgtttctg
actggttgtagtggcaatttaagtcagggaaaaactctacggatagcaacagaaccagcc
tttccaccttttgagtttacagcacaagggggaaatttacagggtttttctatagatttg
atgaatgcgatcgcctctgctgctaatttgaaagtaaatttccaaagtctgccttttgat
gggattatccccgccttgcaaagtagaactgtagacgcggcgattagttccatcaccatc
accgccgaacgggcagaaaccgttgcgttctctcgtccttattttaaagcagggttagcg
atcgctattcgctccagcaatgaagatattacaggctttgacagtctcaaaaataaaaaa
atcgccgtgcagattggcacaactggcgcaggaaaagccaaaagtattccaggggcgcaa
attcgtagctttgattctgcccccctagctctacaagaattacttaataacaatgtagat
gcagtcatcaatgatgcgcctgtaactttatatgccattaacacaggcaatttacaagga
attaaagttgtcgaaaagttgctaacagaagaatattatggtatcgctacagcccaaaat
tcaccttatttagcactaattaatgatggtttaaatcgggtgctagcagatggttcatat
tcccaaatttaccaaaaatggtttaaggtagaacccccatcattaccagataaatcactc
tatgaaaatcaaactaatactcataaatctggctcaattaacctcatattacagtttctc
ccgactttattacaaggtgcattagtcaccatacaactgacaattttatctacggtattg
ggtttaatctgtggtactttaattgccctgactcgtctttcccagtttacccctgcacgt
ttattcgctagagcttacgtagattttttccggggaacacctctgctagtccaaattttt
atgatttattttggaataccagcacttgctcaacaacttggttttacctttaactttgac
cgttgggtggctggagttattgccttaagtgtaaatgcagccgcctacattgctgaaatt
gtccgtgctggtattcaatcaatagaaactggacaaacagaagcagctaaatccttaggt
ttaaatccttggttgacaatgcgtttggtaatttttccccaagccttccggcgaatgtta
ccacctttgggtaatgagtttatcagtttgttaaaagatacgagcttagttgctgtaatt
ggatttgaagagttattccgcaaagggcaattgattgttgcagacaactatcgtgctttt
gaaatttatgcggctgtcgctatagtttatttatgtttaacacttttagcttctcaagtt
ctgagccgtttagaaatgtggatgaatccgaccatgaaagctcaacaacgaaaagcaaaa
agataa

DBGET integrated database retrieval system