KEGG   Nostoc sp. PCC 7120: alr3293Help
Entry
alr3293           CDS       T00069                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana00260  Glycine, serine and threonine metabolism
ana00750  Vitamin B6 metabolism
ana01100  Metabolic pathways
ana01110  Biosynthesis of secondary metabolites
ana01120  Microbial metabolism in diverse environments
ana01230  Biosynthesis of amino acids
Module
ana_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    alr3293 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    alr3293 (thrC)
Enzymes [BR:ana01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     alr3293 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP NinF zinc_ribbon_2
Motif
Other DBs
NCBI-ProteinID: BAB74992
CyanoBase: alr3293
CYORF: alr3293
UniProt: Q8YRZ9
Position
3975897..3977201
Genome map
AA seq 434 aa AA seqDB search
MTQATSTPTQTTNATLSALKCKECGAEYELKATHVCEYCFGPLEVKYDYNALRLSVTREK
IQAGPNSIWRYRPFLPVTTDNVIDVGTGMTPLVRSHRLARRLGLNKLYIKNDAVNMPTLS
FKDRVVSVALSRARELGFTTVSCASTGNLANSTAAIAAHAGLDCCVFIPADLEAGKILGS
LIYSPTLMAVKGNYDQVNRLCSEVANTHGWGFVNINLRPYYSEGSKTLGFEVAEQLGWEL
PDHIVAPLASGSLFTKIYKGFQEFVEVGLVEGKKVRFSGAQAEGCSPIAQAFKEDRDFIK
PVKPNTIAKSIAIGNPADGVYAVDIAKKTGGNIESVNDAEIIEGIKLLAETEGIFTETAG
GTTVAVLKKLVEAGKIDPDETTVVYITGNGLKTQEAVQGYVGEPLTIDAKLDSFERALER
SRTLDRLEWQQVLV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggcaacatctacacccacccaaacgaccaatgccaccctttcagcgttgaag
tgtaaggaatgtggcgcagaatatgaactgaaagctactcatgtgtgtgagtattgtttt
ggcccgttggaagtgaagtatgactacaatgccttacgtctctctgttacccgcgaaaaa
attcaagctgggccaaactcaatttggcgttatcgcccttttctgcctgtcacaactgac
aatgtaattgatgtgggaacaggtatgactcccctggtgcgttcccatcgtcttgcccgt
cgcctgggtctaaacaagctttacattaaaaatgatgcagtgaatatgcccaccctcagc
tttaaggatcgggtggtatccgtcgccctgtctcgcgctagagagttgggattcaccaca
gtttcttgcgctagcactggtaacttagcaaattctacagcagcgatcgccgcccatgcc
ggtttagattgctgtgtgttcatccccgcagatttagaagctggcaaaattctgggtagc
ttaatctacagtcctaccctcatggcggtgaaaggcaactatgatcaagtcaatcgcctt
tgttcggaagtagctaatacacacggttggggctttgtcaatattaacttacgcccctac
tattccgaaggttccaagactttgggctttgaagttgccgaacaactaggctgggaacta
ccagatcatatagttgcacctttggcttctggttcactgttcaccaaaatctataaaggc
ttccaggaattcgtggaagttggtttggtggaagggaagaaagtccgtttcagtggcgca
caggcggaaggttgttcacccatcgcccaagcctttaaagaagacagagactttattaaa
ccagtgaaaccgaatacaattgccaaatcaattgcgatcggtaatccagcagatggtgtt
tatgctgttgatattgccaagaaaactggcggtaatattgaatcagtgaatgatgcagaa
attatcgaaggtatcaagctactggcagaaaccgaaggcatctttacagaaacagctggt
ggtacaactgttgctgtgctgaaaaaattggtagaagctggcaaaattgatccagacgaa
accaccgtggtttacatcactggcaatggtttgaaaacccaagaagccgtacaaggctac
gttggcgaacctttgacaattgatgccaaattagatagttttgagcgtgctttagagcgt
tcacgtaccctcgaccgcttggaatggcaacaagtcctcgtttag

DBGET integrated database retrieval system