KEGG   Nostoc sp. PCC 7120: alr3441Help
Entry
alr3441           CDS       T00069                                 

Gene name
chlB
Definition
(GenBank) protochlorophyllide reductase ChlB subunit
  KO
K04039  light-independent protochlorophyllide reductase subunit B [EC:1.3.7.7]
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana00860  Porphyrin and chlorophyll metabolism
ana01100  Metabolic pathways
ana01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ana00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    alr3441 (chlB)
Enzymes [BR:ana01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     alr3441 (chlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro PCP_red
Motif
Other DBs
NCBI-ProteinID: BAB75140
CyanoBase: alr3441
CYORF: alr3441
UniProt: Q8YRK5
Position
4147164..4148690
Genome map
AA seq 508 aa AA seqDB search
MKLAYWMYAGPAHIGTLRVATSFKNVHAIMHAPLGDDYFNVMRSMLSRERDFTPVTTSVV
DRHVLARGSQEKVVDNITRKDAEERPDLIVLTPTCTSSILQEDLENFVERAQLEAKGDVL
LADVNHYRVNELQAGDRTLHQIVQYYIEKARKKGELPEGKTAKPSVNIIGISTLGFHNNH
DCTELKRLMADLGIEVNAVIPEGASVHELKNLPRAWFNLVPYRELGLMTANYLEKEFGTP
CIDIVPMGVVETARCIRKIQEVINAQGADVNYEDYINEQTLYVSQAAWFSRSIDCQNLTG
KKAVVFGDNTHAAALTKILSREMGIHVVWAGTYCKYDADWFREQVSEYCDEVLITEDHGE
IGDAIARVEPSAIFGTQMERHVGKRLDIPCGVIAAPIHVQNFPIGYKPFLGYEGTNQITD
LIYNSFTLGMEDHLLEIFGGHDTKEVITKGISAGSDLSWTKDGLAELNKIPGFVRGKVKR
NTEKFARDRGFKDISAEVLYAAKEAVGA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaaattggcttactggatgtatgcaggccccgcccacattggcactttgcgagtcgca
acttcatttaaaaacgtccatgctattatgcacgcgcctctgggtgatgactactttaat
gtcatgcgctcaatgctatcgcgggagagggacttcacaccagtaacaaccagtgtggtt
gaccgccatgttttagcccgtggttctcaagaaaaggtggtagataatattacccgcaaa
gatgcagaagaacgcccagatttaattgtcttaactcccacctgtacctccagtattctg
caagaagacctagaaaacttcgtcgaacgcgcccagttggaggcaaaaggggacgtgttg
ctggcggatgtgaaccactatcgggtaaacgaactgcaagcaggcgatcgcactctccac
caaattgttcaatactatattgaaaaagcccgcaaaaaaggcgaactcccagaaggtaaa
accgccaagccctcagttaacatcatcggcatttctaccctggggttccacaataaccac
gactgcaccgaactcaaaaggctgatggctgatttgggaattgaggtcaacgcggtcatt
cctgaaggcgcttctgttcacgagttgaagaatttacccagagcttggtttaacctcgtt
ccttaccgggaattgggtttaatgacagctaattacctagaaaaggaatttggcacacct
tgcatagatattgtgccaatgggtgtagtagaaactgcccgttgtatccgtaagattcag
gaagtgattaacgctcaaggtgctgatgttaattacgaagactacatcaacgagcaaacc
ttgtatgtatcccaagctgcttggttctcccgttccatcgactgtcaaaacctgactggt
aaaaaagccgttgtttttggcgacaacacccacgccgccgccttgacaaagattttgtca
cgagaaatggggattcacgttgtttgggcgggaacctactgcaagtatgatgctgattgg
ttccgcgaacaggtaagcgagtattgcgatgaagttctgattaccgaagatcatggggaa
attggggatgcgatcgcccgtgttgaaccctctgccatcttcggtacacaaatggaacgc
cacgttggtaagcgtttagatattccttgtggtgtgattgctgcacccattcacgtacaa
aacttccccatcggttacaaaccattcttgggttatgaaggaaccaatcaaattaccgat
ttaatctacaattccttcactttaggtatggaagaccacctattagaaatatttggtgga
cacgatacgaaggaagtaattactaaaggtatttctgctggttctgacctgagttggaca
aaagatggcttggcagaattgaataaaattcctggttttgtgcgcggaaaagtcaagcgg
aatacagaaaaattcgcacgcgatcgcggtttcaaagatatctcagcagaggtgttatat
gcagccaaggaagcggtaggagcataa

DBGET integrated database retrieval system