KEGG   Anabaena sp. 90: ANA_C10752Help
Entry
ANA_C10752        CDS       T02341                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
anb  Anabaena sp. 90
Pathway
anb00020  Citrate cycle (TCA cycle)
anb00480  Glutathione metabolism
anb01100  Metabolic pathways
anb01110  Biosynthesis of secondary metabolites
anb01120  Microbial metabolism in diverse environments
anb01200  Carbon metabolism
anb01210  2-Oxocarboxylic acid metabolism
anb01230  Biosynthesis of amino acids
Module
anb_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:anb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ANA_C10752
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ANA_C10752
Enzymes [BR:anb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ANA_C10752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AFW93546
UniProt: K7WSU1
Position
chANA01:809407..810828
Genome map
AA seq 473 aa AA seqDB search
MYEKITPPTTGAKITFKNGEPVVPENPIIPFIRGDGTGIDIWPATEKVLDAAIAKAYNGQ
RKISWFRVYAGDEACDLYGTYQYLPQDTLTAIKEYGIAIKGPLTTPVGGGIRSLNVALRQ
IFDLYTCVRPCRYYAGTPSPHKTPEKLDVIVYRENTEDIYLGIEWKQGSEIGDRLIKFLN
EELIPATPEHGKKQIPLDAGIGIKPISKTGSQRLVRRAIKHALLLPKNKQQVTLVHKGNI
MKYTEGAFRDWGYELATTEFRQETVTERESWILGNKEKNPHISAEENAHEIDPGFDSLTP
EKKAQIVKEVETVLNTIWESHGNGKWKEKIMVNDRIADSIFQQIQTRPDEYSILATMNLN
GDYLSDAAAAIVGGLGMGPGANIGDSCAIFEATHGTAPKHAGLDRINPGSVILSGVMMLE
YMGWQEAADLIKKGLGDAIANGQVTYDLARLMEPPVQPLKCSEFADAIIKHFG
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaaaagattactcctcccaccaccggcgcgaaaattaccttcaaaaatggtgaa
ccggttgttcctgaaaatcccattattccctttattcgcggtgacggtacgggtatagat
atttggccggcgacggaaaaagtgcttgatgctgcgatcgctaaagcatacaatggtcaa
agaaaaattagctggtttagggtttatgctggtgatgaagcctgtgatttgtacggcaca
tatcagtatttgccccaggatacattgacggctattaaagaatatggcatagcaattaaa
ggacctctaactactcccgttggtggtggaattcggtctttaaatgtggcattacgccaa
atctttgacctttatacttgcgtgcgtccttgtcgttattacgctgggacaccttctccc
cacaaaactcctgaaaaactggatgtgattgtttatcgggaaaatacggaagatatttat
ttggggattgagtggaagcaaggtagtgaaatcggcgatcgcctgataaaattcttaaat
gaagaattgatacccgctaccccagaacacggtaaaaagcaaattcccctcgatgctggt
atcggtatcaaacccatcagcaaaactggttctcagcgtttagttagacgtgctattaaa
cacgccttattattgcccaaaaataagcaacaagtcaccttggtgcataaaggcaatatc
atgaaatacacagaaggcgctttccgggattggggttatgaattagccacaacggaattc
cgtcaagaaactgtaacagaacgggaatcttggattttgggtaataaggaaaaaaatccc
catatttccgcagaagaaaatgcccatgaaattgatcccggttttgattctttgactcca
gagaaaaaagcgcaaattgtcaaagaagtagaaacagttctaaatacaatttgggaaagt
cacggaaacggcaaatggaaagaaaaaatcatggtcaatgatcgcattgctgatagtatc
tttcaacaaattcaaactcgtccagatgagtattctattctggcgacaatgaacctcaac
ggtgattatttatctgatgctgctgctgctatcgttggcggtttaggcatgggtccaggg
gcaaatattggcgactcctgcgcgatttttgaagctacccatgggacagccccaaaacac
gctgggttagacagaattaaccccggttctgtaattctttccggtgtaatgatgctggaa
tatatgggttggcaagaagccgcagatttgattaaaaaaggattaggtgatgccatagca
aatggtcaagttacctatgacttagcgcggttaatggaaccacctgtacaaccattaaaa
tgttctgaatttgctgacgcaatcatcaaacatttcggttaa

DBGET integrated database retrieval system