KEGG   Anabaena sp. 90: ANA_C11265Help
Entry
ANA_C11265        CDS       T02341                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal subunit L22
  KO
K02890  large subunit ribosomal protein L22
Organism
anb  Anabaena sp. 90
Pathway
anb03010  Ribosome
Brite
KEGG Orthology (KO) [BR:anb00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    ANA_C11265 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:anb03011]
    ANA_C11265 (rplV)
Ribosome [BR:anb03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    ANA_C11265 (rplV)
  Bacteria
    ANA_C11265 (rplV)
  Archaea
    ANA_C11265 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AFW94045
UniProt: K7VV78
Position
chANA01:complement(1403013..1403378)
Genome map
AA seq 121 aa AA seqDB search
MKMATDTTEVKAIARYIRISPYKVRRVLDQIRGRSYREALILLEFMPYGACDPILKVLRS
AAANAEHNAGLDRSSLVISQAYADQGPVLKRFQPRAQGRAYQIRKPTCHITVAVSAVATA
E
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatggcaactgacactactgaagttaaggcaatcgcccgctatatacgcatttct
ccctataaagtgcgccgtgtacttgatcaaattcgcggccgttcatacagagaagcacta
atcttgctcgaatttatgccctatggcgcttgtgaccccatcttaaaggttctcagaagt
gccgcagctaatgccgagcataatgctggtttagacagatccagtttggtgatcagtcaa
gcctatgccgaccaaggaccagtgctaaaacggtttcaacccagagcgcaaggtcgagct
taccaaattcgcaaaccaacgtgtcatatcactgttgctgtttccgcggttgctactgct
gagtaa

DBGET integrated database retrieval system